(data stored in ACNUC30630 zone)

EMBL: BX251410.PE45

BX251410.PE45        Location/Qualifiers
FT   CDS             42189..42587
FT                   /transl_table=11
FT                   /locus_tag="TW048"
FT                   /product="putative secreted protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66737.1"
FT                   /translation="MKKLTTVSITVLSIVTLLFIAQPAQASEGNLEANQGTKLKRVTRS
FT                   VKTFDVDKCLNGAVSGAVGVGGGFAGAQAAKLIIKGVSAVNPATFAAVTAGTAVADCVM
FT                   HGGLVDDVVNGFNAGFNAVGDFIGKLFG"
     MKKLTTVSIT VLSIVTLLFI AQPAQASEGN LEANQGTKLK RVTRSVKTFD VDKCLNGAVS        60
     GAVGVGGGFA GAQAAKLIIK GVSAVNPATF AAVTAGTAVA DCVMHGGLVD DVVNGFNAGF       120
     NAVGDFIGKL FG                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page