(data stored in ACNUC30630 zone)

EMBL: BX251410.PE46

BX251410.PE46        Location/Qualifiers
FT   CDS             42584..42982
FT                   /transl_table=11
FT                   /locus_tag="TW049"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66738.1"
FT                   /translation="MNASTLGGRLKNSRLFIVACMLLLIPLFIYVVLSGYSLGYAFGAA
FT                   LALAFTCPGVVRSVFNGSFSLDLGNPFLAAIGLLGAGYLILMTLSPVLWLLFSQTFMFY
FT                   FNAVMFTMLFVALQCALARWAVLSRRAG"
     MNASTLGGRL KNSRLFIVAC MLLLIPLFIY VVLSGYSLGY AFGAALALAF TCPGVVRSVF        60
     NGSFSLDLGN PFLAAIGLLG AGYLILMTLS PVLWLLFSQT FMFYFNAVMF TMLFVALQCA       120
     LARWAVLSRR AG                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page