(data stored in ACNUC30630 zone)

EMBL: BX251410.PE49

BX251410.PE49        Location/Qualifiers
FT   CDS             44219..44608
FT                   /transl_table=11
FT                   /locus_tag="TW053"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66741.1"
FT                   /translation="MARITRNTSVPVLILCCLLSIPLLAIVGVILVLAGSELWFIPAFV
FT                   LFLMFIFGPEHHVTDYNLWEALFAGLIMGGSLAMLTTCSVVNFVYPELWLLRSPGFSIA
FT                   CTVAFAIAAAFFLAVDLRRKIKQGQ"
     MARITRNTSV PVLILCCLLS IPLLAIVGVI LVLAGSELWF IPAFVLFLMF IFGPEHHVTD        60
     YNLWEALFAG LIMGGSLAML TTCSVVNFVY PELWLLRSPG FSIACTVAFA IAAAFFLAVD       120
     LRRKIKQGQ                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page