(data stored in ACNUC30630 zone)

EMBL: BX251410.PE50

BX251410.PE50        Location/Qualifiers
FT   CDS             complement(44860..46251)
FT                   /transl_table=11
FT                   /locus_tag="TW054"
FT                   /product="putative two component system sensor kinase"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   protein Rv0758 or mt0783 or mtcy369.03 SWALL:P71815
FT                   (EMBL:Z80226) (485 aa) fasta scores: E(): 8.9e-37, 31.11%
FT                   id in 466 aa, and to Streptomyces coelicolor putative two
FT                   component system histidine kinase SCO4021 or 2SC10A7.25
FT                   SWALL:Q9ADN6 (EMBL:AL583945) (524 aa) fasta scores: E():
FT                   5.5e-27, 37.73% id in 265 aa"
FT                   /protein_id="CAD66742.1"
FT                   /translation="MVTLVALVLAFSFTAVGIGTTLVIKNEMIKTIDEQLIHISGTFPL
FT                   FESSFEVFSPGRASYKAHIYKFDGTLIWPIGENPSIEFDRKIDITLYNEKGNTPFTLHS
FT                   ISRQKKYRMLLQPLETGSGQEILAYYLPQSGTENTANFYQRSYIWFSLAVFAIAAYIVY
FT                   LITAHTLSPLYALEKTARAFARGDYSRRIRSEYVSAEILNLNKSLNSMLDSLEKALGER
FT                   DKTLGEMKQFLADASHELRTPLVSLRGYAELYRIGALKGKEDIDNAIERIEKEAIRMGT
FT                   MVEDLLSLTRLEKATDLVPVDVKYLVQESVIDMNVLEKTRKITTGIPKRQSCMILGNEN
FT                   MLRRLLANLINNALHYTPPGSPIEIVLRTDKTDVVIDVRDHGPGVPRQLHDKVFKRFWR
FT                   SDASRARNSGGVGLGLSIVASIVKVHKGTIEILRTRGGGATFRTRIPKLVNKHRSGSSS
FT                   HSLTR"
     MVTLVALVLA FSFTAVGIGT TLVIKNEMIK TIDEQLIHIS GTFPLFESSF EVFSPGRASY        60
     KAHIYKFDGT LIWPIGENPS IEFDRKIDIT LYNEKGNTPF TLHSISRQKK YRMLLQPLET       120
     GSGQEILAYY LPQSGTENTA NFYQRSYIWF SLAVFAIAAY IVYLITAHTL SPLYALEKTA       180
     RAFARGDYSR RIRSEYVSAE ILNLNKSLNS MLDSLEKALG ERDKTLGEMK QFLADASHEL       240
     RTPLVSLRGY AELYRIGALK GKEDIDNAIE RIEKEAIRMG TMVEDLLSLT RLEKATDLVP       300
     VDVKYLVQES VIDMNVLEKT RKITTGIPKR QSCMILGNEN MLRRLLANLI NNALHYTPPG       360
     SPIEIVLRTD KTDVVIDVRD HGPGVPRQLH DKVFKRFWRS DASRARNSGG VGLGLSIVAS       420
     IVKVHKGTIE ILRTRGGGAT FRTRIPKLVN KHRSGSSSHS LTR                         463
//

If you have problems or comments...

PBIL Back to PBIL home page