(data stored in ACNUC30630 zone)

EMBL: BX251410.PE51

BX251410.PE51        Location/Qualifiers
FT   CDS             complement(46318..47001)
FT                   /transl_table=11
FT                   /locus_tag="TW055"
FT                   /product="putative two component system response regulator"
FT                   /note="Similar to Streptomyces coelicolor putative two
FT                   component system response regulator SCO4020 or 2SC10A7.24
FT                   SWALL:Q9ADN7 (EMBL:AL583945) (271 aa) fasta scores: E():
FT                   1.2e-40, 50.44% id in 226 aa"
FT                   /protein_id="CAD66743.1"
FT                   /translation="MSQTKILVVDDEANIRDLLAASLRFAGYGVVTAGNGAGAVSAVLA
FT                   EEPDLIIMDVMLPDMSGFAATKRLREAGFRCPVIFLSARDSTEDKITGLTVGGDDYVTK
FT                   PFSLDEILARVAAILRRTKIDDVDATIRVGDLVIDQNSNEVFLKGNLIDLSPTEFKLLR
FT                   YFMLNPNRVLSKSQILGHVWDYDFDGDSSIVESYISYIRRKLAAYSSETIIHTKRGFGY
FT                   IMRTR"
     MSQTKILVVD DEANIRDLLA ASLRFAGYGV VTAGNGAGAV SAVLAEEPDL IIMDVMLPDM        60
     SGFAATKRLR EAGFRCPVIF LSARDSTEDK ITGLTVGGDD YVTKPFSLDE ILARVAAILR       120
     RTKIDDVDAT IRVGDLVIDQ NSNEVFLKGN LIDLSPTEFK LLRYFMLNPN RVLSKSQILG       180
     HVWDYDFDGD SSIVESYISY IRRKLAAYSS ETIIHTKRGF GYIMRTR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page