(data stored in ACNUC30630 zone)

EMBL: BX251410.PE53

BX251410.PE53        Location/Qualifiers
FT   CDS             47741..47968
FT                   /transl_table=11
FT                   /locus_tag="TW058"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66745.1"
FT                   /translation="MRYVNLTCGYTGWFWIAAVNKTADGDLNVLELYPSPGPGALAFTA
FT                   RSDQIATGGEYDDDESGDLITPVDRDGLDF"
     MRYVNLTCGY TGWFWIAAVN KTADGDLNVL ELYPSPGPGA LAFTARSDQI ATGGEYDDDE        60
     SGDLITPVDR DGLDF                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page