(data stored in ACNUC30630 zone)

EMBL: BX251410.PE54

BX251410.PE54        Location/Qualifiers
FT   CDS             47971..48753
FT                   /transl_table=11
FT                   /locus_tag="TW059"
FT                   /product="putative sporulation/chromosome partition
FT                   protein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   partitioning or sporulation protein SCO1772 or SCI51.12c
FT                   SWALL:Q9S228 (EMBL:AL109848) (340 aa) fasta scores: E():
FT                   9.9e-52, 57.14% id in 252 aa, and to Bacillus subtilis
FT                   sporulation initiation inhibitor protein Soj
FT                   SWALL:SOJ_BACSU (SWALL:P37522) (253 aa) fasta scores: E():
FT                   2.6e-38, 46.21% id in 251 aa"
FT                   /protein_id="CAD66746.1"
FT                   /translation="MTKKSARTVAVCNQKGGVGKTTTTINLAACLAERGMRVLTVDLDP
FT                   QGALTAGFGISNFEYTVYDLLLGRNRNAVLIQTSLKGVDVLPANIDLSAAEVYLVSEVA
FT                   REQILAKELESFSSDYDVILIDCQPSLGLLTINALTASHGLLIPLECEYFAMRGLALLL
FT                   ETVRKIQDRLNTALKVDGIIATMFDMRTLHAREVLESVKKAFPGLLLTTVINRTIKFPD
FT                   SSIAGMPVTVFAPNHQASKNYRDLTHELVHRGVFTLPS"
     MTKKSARTVA VCNQKGGVGK TTTTINLAAC LAERGMRVLT VDLDPQGALT AGFGISNFEY        60
     TVYDLLLGRN RNAVLIQTSL KGVDVLPANI DLSAAEVYLV SEVAREQILA KELESFSSDY       120
     DVILIDCQPS LGLLTINALT ASHGLLIPLE CEYFAMRGLA LLLETVRKIQ DRLNTALKVD       180
     GIIATMFDMR TLHAREVLES VKKAFPGLLL TTVINRTIKF PDSSIAGMPV TVFAPNHQAS       240
     KNYRDLTHEL VHRGVFTLPS                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page