(data stored in ACNUC30630 zone)

EMBL: BX251410.PE55

BX251410.PE55        Location/Qualifiers
FT   CDS             48827..49963
FT                   /transl_table=11
FT                   /locus_tag="TW060"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Staphylococcus aureus prephenate
FT                   dehydrogenase TyrA or Mw1252 SWALL:BAB95117 (EMBL:AP004826)
FT                   (363 aa) fasta scores: E(): 8.9e-10, 27.5% id in 389 aa"
FT                   /protein_id="CAD66747.1"
FT                   /translation="MYVHIIGAGLIGGSIALGLSRAGLKVSASDISPAAQRLSKLGDIS
FT                   IGPPNQNPDLVFVCTPPDVTAAEVVSSLDRFPETCVVDVSSVKTRIYREVLRKTHPAKR
FT                   VFYIQSHPMAGREIGGIQGASADLFSGWPWIVCHSFVCGDGNDQMNGENSVHQKNYLTR
FT                   NTEDEAEWSLGKNLLHCINLLGAFPVFMDRDRHDRSVAAVSHVPHILSSLIALSLANTD
FT                   QGTVAICGSGIKDMTRLAASNPELWTQIIFSNRREILQSLGVFSGLLKRMLHTLEKLDN
FT                   PAYRTDLFSQLAEAQAQQARIPKKPGKNLDYSQLEVLIPDKPGELSKVLGAINTQGINL
FT                   EDLHFEHANNLGVVKLSVSNKDRCRLMDTLEDKWTLLV"
     MYVHIIGAGL IGGSIALGLS RAGLKVSASD ISPAAQRLSK LGDISIGPPN QNPDLVFVCT        60
     PPDVTAAEVV SSLDRFPETC VVDVSSVKTR IYREVLRKTH PAKRVFYIQS HPMAGREIGG       120
     IQGASADLFS GWPWIVCHSF VCGDGNDQMN GENSVHQKNY LTRNTEDEAE WSLGKNLLHC       180
     INLLGAFPVF MDRDRHDRSV AAVSHVPHIL SSLIALSLAN TDQGTVAICG SGIKDMTRLA       240
     ASNPELWTQI IFSNRREILQ SLGVFSGLLK RMLHTLEKLD NPAYRTDLFS QLAEAQAQQA       300
     RIPKKPGKNL DYSQLEVLIP DKPGELSKVL GAINTQGINL EDLHFEHANN LGVVKLSVSN       360
     KDRCRLMDTL EDKWTLLV                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page