(data stored in ACNUC30630 zone)

EMBL: BX251410.PE56

BX251410.PE56        Location/Qualifiers
FT   CDS             49945..52005
FT                   /transl_table=11
FT                   /locus_tag="TW061"
FT                   /product="putative GTP-binding protein"
FT                   /note="Similar to many eg. Streptomyces coelicolor putative
FT                   GTP binding protein SCO1758 or 2SCI34.11c SWALL:Q9EWW8
FT                   (EMBL:AL445403) (492 aa) fasta scores: E(): 8.6e-84, 49.49%
FT                   id in 493 aa. N-terminal region contains match to Pfam
FT                   PF02224 Cytidylate kinase."
FT                   /protein_id="CAD66748.1"
FT                   /translation="MDFTSIVAIDGPAGSGKSSVGRAVAQYLGYGFLPTGSYYRAFAFL
FT                   LDQTKDLDSQLDSFISSVRNDLDPYNSGFNVHIDDSPFFGSSGISASSRNIASELNNPE
FT                   ITSKTAAVARNKSVRVRLNEYFRKLCSESIYPAIVLEGRDATTVIAPNARVKIFLTASL
FT                   VKRAARRSEQLSSEPPNSVLEALRQRDEADNAVTDFLSDDSSRITLDTSDLTFSESVAR
FT                   VLEVIEQAGMPFVSDKWVGENADVLAASGELGATVVIVGRPNVGKSALVNCILGRREAV
FT                   VENRPGVTRDRVVYPAFWAGRPFTLVDTGGWECDAEGLDAEVVAQAEIGMSIADIIIFV
FT                   VDVQHGPVSTDAVIARNLQRQNKPIFLVANKADNASSDSDVAQFWSLGLGQPYACSATH
FT                   GRGVADLMDIVMQSAQVHTPSFCSGAPRVALIGRPNVGKSSLINQLTNSRRAIVDDLAG
FT                   TTRDPLDALAVIGDKSWLFVDTAGLRRKFKSQKGADFYAYLRATTVLRRTEIALLLLDA
FT                   SHAITEQDVRIAEMVVESGRALVIAINKWDLLDEERRYWLEREIDNTFFRFAWAPRVNI
FT                   SARTGRGVKQLATALQTALTNWNTRLNTARVNHFLQRITREQPHPTRGGRRPRILFASQ
FT                   TGVAPPTFTLFTTGFLEPTYRRFLQKSIRSQHSFTGSPIILSVKIRASRNR"
     MDFTSIVAID GPAGSGKSSV GRAVAQYLGY GFLPTGSYYR AFAFLLDQTK DLDSQLDSFI        60
     SSVRNDLDPY NSGFNVHIDD SPFFGSSGIS ASSRNIASEL NNPEITSKTA AVARNKSVRV       120
     RLNEYFRKLC SESIYPAIVL EGRDATTVIA PNARVKIFLT ASLVKRAARR SEQLSSEPPN       180
     SVLEALRQRD EADNAVTDFL SDDSSRITLD TSDLTFSESV ARVLEVIEQA GMPFVSDKWV       240
     GENADVLAAS GELGATVVIV GRPNVGKSAL VNCILGRREA VVENRPGVTR DRVVYPAFWA       300
     GRPFTLVDTG GWECDAEGLD AEVVAQAEIG MSIADIIIFV VDVQHGPVST DAVIARNLQR       360
     QNKPIFLVAN KADNASSDSD VAQFWSLGLG QPYACSATHG RGVADLMDIV MQSAQVHTPS       420
     FCSGAPRVAL IGRPNVGKSS LINQLTNSRR AIVDDLAGTT RDPLDALAVI GDKSWLFVDT       480
     AGLRRKFKSQ KGADFYAYLR ATTVLRRTEI ALLLLDASHA ITEQDVRIAE MVVESGRALV       540
     IAINKWDLLD EERRYWLERE IDNTFFRFAW APRVNISART GRGVKQLATA LQTALTNWNT       600
     RLNTARVNHF LQRITREQPH PTRGGRRPRI LFASQTGVAP PTFTLFTTGF LEPTYRRFLQ       660
     KSIRSQHSFT GSPIILSVKI RASRNR                                            686
//

If you have problems or comments...

PBIL Back to PBIL home page