(data stored in ACNUC30630 zone)

EMBL: BX251410.PE58

BX251410.PE58        Location/Qualifiers
FT   CDS             53375..54094
FT                   /transl_table=11
FT                   /locus_tag="TW063"
FT                   /product="putative ubiquinone/menaquinone
FT                   methyltransferase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ubiquinone/menaquinone methyltransferase SCO4556 or
FT                   SCD16a.27c SWALL:Q9XAP8 (EMBL:AL078618) (231 aa) fasta
FT                   scores: E(): 1.6e-29, 42.17% id in 230 aa, and to
FT                   Escherichia coli, and Escherichia coli O157:H7
FT                   ubiquinone/menaquinone biosynthesis methyltransferase UbiE
FT                   or b3833 or z5355 or ecs4763 SWALL:UBIE_ECOLI
FT                   (SWALL:P27851) (251 aa) fasta scores: E(): 6.5e-23, 36.32%
FT                   id in 245 aa"
FT                   /db_xref="GOA:P67065"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67065"
FT                   /protein_id="CAD66750.1"
FT                   /translation="MGTNIHIDMVIHGKHTAEIRKMFNRVAQAYDRTNLVLSFLQDAHW
FT                   RRAACKMLGVTAGEEVLDVGAGTGASTRTVARTGAAVTGIDISPRMLQIARNRCKRFQN
FT                   ITWRLTNGDLPFPDKSFDAILMVFCLRNVSNIQGFLCDAARVLKPGGRLVVCEFSHPRR
FT                   FVAPFYRLYLRYVLPRLAKLISSDPAAYEYLTESIEDWYEVDELAFMLEQCGFQNTSWK
FT                   RLSFGAVALHRALRGPE"
     MGTNIHIDMV IHGKHTAEIR KMFNRVAQAY DRTNLVLSFL QDAHWRRAAC KMLGVTAGEE        60
     VLDVGAGTGA STRTVARTGA AVTGIDISPR MLQIARNRCK RFQNITWRLT NGDLPFPDKS       120
     FDAILMVFCL RNVSNIQGFL CDAARVLKPG GRLVVCEFSH PRRFVAPFYR LYLRYVLPRL       180
     AKLISSDPAA YEYLTESIED WYEVDELAFM LEQCGFQNTS WKRLSFGAVA LHRALRGPE        239
//

If you have problems or comments...

PBIL Back to PBIL home page