(data stored in ACNUC30630 zone)

EMBL: BX251410.PE59

BX251410.PE59        Location/Qualifiers
FT   CDS             54106..55122
FT                   /transl_table=11
FT                   /locus_tag="TW064"
FT                   /product="putative polyprenyl diphosphate synthase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   transferase SCO4583 or SCD20.01 SWALL:Q9F2X8
FT                   (EMBL:AL392148) (336 aa) fasta scores: E(): 3.3e-37, 38.19%
FT                   id in 343 aa, and to Gluconobacter oxydans decaprenyl
FT                   diphosphate synthase DdsA SWALL:O82832 (EMBL:AB006850) (315
FT                   aa) fasta scores: E(): 2.4e-23, 32.55% id in 301 aa"
FT                   /protein_id="CAD66751.1"
FT                   /translation="MLVSGIFLSDILDPSGSLSDDISPALDRVEDLLLETVGDCHEIVS
FT                   HLLVSGGKRARPLLVLLTSCMGSGINDAVIRAAAGIELIHLGSLYHDDVMDNAYIRHGS
FT                   ITAHRLWGKSAAILAGDFLFAKAGVLGLNLDKRAIAVQTEAFQRMISGQLSETLGISDS
FT                   LDPLEAYIEVSRGKTGSLIAASAQVGAILGDASLSTLEPLRDFGESIGVAFQLVDDVID
FT                   LSGKSGKTPGSDIRAGVMSLPILLLSNAAKDDRDSAVLLEEIERVRRHSGACGSDDYSS
FT                   EMNAVLAHLRKHDVTARTLEIARTWGDKAKHALKKLPECAPRDALLAFVETVVSREF"
     MLVSGIFLSD ILDPSGSLSD DISPALDRVE DLLLETVGDC HEIVSHLLVS GGKRARPLLV        60
     LLTSCMGSGI NDAVIRAAAG IELIHLGSLY HDDVMDNAYI RHGSITAHRL WGKSAAILAG       120
     DFLFAKAGVL GLNLDKRAIA VQTEAFQRMI SGQLSETLGI SDSLDPLEAY IEVSRGKTGS       180
     LIAASAQVGA ILGDASLSTL EPLRDFGESI GVAFQLVDDV IDLSGKSGKT PGSDIRAGVM       240
     SLPILLLSNA AKDDRDSAVL LEEIERVRRH SGACGSDDYS SEMNAVLAHL RKHDVTARTL       300
     EIARTWGDKA KHALKKLPEC APRDALLAFV ETVVSREF                               338
//

If you have problems or comments...

PBIL Back to PBIL home page