(data stored in ACNUC30630 zone)

EMBL: BX251410.PE60

BX251410.PE60        Location/Qualifiers
FT   CDS             55141..56484
FT                   /transl_table=11
FT                   /locus_tag="TW065"
FT                   /product="putative ferredoxin/ferredoxin-NADP reductase"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   ferredoxin/ferredoxin-NADP reductase SCO0681 or SCF15.02
FT                   SWALL:Q9RK35 (EMBL:AL132856) (454 aa) fasta scores: E():
FT                   1.3e-71, 43.55% id in 450 aa, and to Rattus norvegicus
FT                   NADPH:adrenodoxin oxidoreductase, mitochondrial precursor
FT                   FdxR SWALL:ADRO_RAT (SWALL:P56522) (494 aa) fasta scores:
FT                   E(): 7.4e-33, 35.16% id in 455 aa"
FT                   /protein_id="CAD66752.1"
FT                   /translation="MARIAVVGAGPAGIYSANLLLADESVERVDVFEALPAPYGLVRYG
FT                   VAPDHPRIKSVVSTLSDMLETPRMRLFCGVHFGQHLSLEDIKQRYNAVIFATGALRGAR
FT                   LDIPGIDARNSFSAADFVAWYDGHPDYPRTWPLSAKSVGIIGNGNVALDIARILVKQPE
FT                   ELETTEIPDNVYEDLKSSALSDVHIFGRRGPFDVKFTPLELRELGEVNGVDIVLNEDDF
FT                   QVKPDRLVKQMIIIDRVFSSWRARSGTSSTRRLHFHFYSVPKRVVVRDNCVSGLEYQQL
FT                   RPTIDACDCVAPPRDSDTRHEVVELDALYTAIGYYGSPLSDLPFDDISGIIPNDRGRVI
FT                   IEGKPLRGCYVTGWIKRGPVGLIGHTKSDAIETIVSMRQDKTAWWKPDTDSDISDLLGS
FT                   RGVNFTGVSGWRKLDAHEIYLGSLSGKTRKKVVPREEMYYISSRGSPS"
     MARIAVVGAG PAGIYSANLL LADESVERVD VFEALPAPYG LVRYGVAPDH PRIKSVVSTL        60
     SDMLETPRMR LFCGVHFGQH LSLEDIKQRY NAVIFATGAL RGARLDIPGI DARNSFSAAD       120
     FVAWYDGHPD YPRTWPLSAK SVGIIGNGNV ALDIARILVK QPEELETTEI PDNVYEDLKS       180
     SALSDVHIFG RRGPFDVKFT PLELRELGEV NGVDIVLNED DFQVKPDRLV KQMIIIDRVF       240
     SSWRARSGTS STRRLHFHFY SVPKRVVVRD NCVSGLEYQQ LRPTIDACDC VAPPRDSDTR       300
     HEVVELDALY TAIGYYGSPL SDLPFDDISG IIPNDRGRVI IEGKPLRGCY VTGWIKRGPV       360
     GLIGHTKSDA IETIVSMRQD KTAWWKPDTD SDISDLLGSR GVNFTGVSGW RKLDAHEIYL       420
     GSLSGKTRKK VVPREEMYYI SSRGSPS                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page