(data stored in ACNUC30630 zone)

EMBL: BX251410.PE61

BX251410.PE61        Location/Qualifiers
FT   CDS             complement(56824..57795)
FT                   /transl_table=11
FT                   /locus_tag="TW066"
FT                   /product="putative iron-siderophore binding lipoprotein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   iron-siderophore binding lipoprotein SCO0494 or SCF34.13c
FT                   SWALL:Q9RK12 (EMBL:AL109974) (350 aa) fasta scores: E():
FT                   7.7e-19, 30.97% id in 339 aa, and to Corynebacterium
FT                   diphtheriae DtxR/iron regulated lipoprotein precursor Irp1
FT                   SWALL:Q46023 (EMBL:U02617) (355 aa) fasta scores: E():
FT                   1e-12, 31.02% id in 303 aa"
FT                   /protein_id="CAD66753.1"
FT                   /translation="MFGRKLLGALVALSLLTGCFGGKGDSESSSVLSKVETVFGEVTIP
FT                   RPKGHDLRVVALGWSDAEAALAVGIKPVAVYDWISFGNKGVGPWAEGLFGDVKPEVISR
FT                   GTDGLNWEQIHNLKPDLILNVRSNNDEKTYKRLSQIAPTVYGPPGTKSWVLNWRDQQRQ
FT                   VAKALGRVKEGEEAIKKTEKAIKDAQDPLYRGLKGAFVAKFAEYGVYLPGDGRWDLMQE
FT                   LGFTLEPKINELPKAGFYAKIPTDKLSWVDTDVLIVISIGTDDITKDALLSSLKAAKEG
FT                   RVIYANKDLANVLSASSALSIREAIKRISDKLREIAKKLRNK"
     MFGRKLLGAL VALSLLTGCF GGKGDSESSS VLSKVETVFG EVTIPRPKGH DLRVVALGWS        60
     DAEAALAVGI KPVAVYDWIS FGNKGVGPWA EGLFGDVKPE VISRGTDGLN WEQIHNLKPD       120
     LILNVRSNND EKTYKRLSQI APTVYGPPGT KSWVLNWRDQ QRQVAKALGR VKEGEEAIKK       180
     TEKAIKDAQD PLYRGLKGAF VAKFAEYGVY LPGDGRWDLM QELGFTLEPK INELPKAGFY       240
     AKIPTDKLSW VDTDVLIVIS IGTDDITKDA LLSSLKAAKE GRVIYANKDL ANVLSASSAL       300
     SIREAIKRIS DKLREIAKKL RNK                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page