(data stored in ACNUC30630 zone)

EMBL: BX251410.PE62

BX251410.PE62        Location/Qualifiers
FT   CDS             complement(57921..58916)
FT                   /transl_table=11
FT                   /locus_tag="TW067"
FT                   /product="putative iron-siderophore binding lipoprotein"
FT                   /note="Similar to Streptomyces coelicolor putative
FT                   iron-siderophore binding lipoprotein SCO0494 or SCF34.13c
FT                   SWALL:Q9RK12 (EMBL:AL109974) (350 aa) fasta scores: E():
FT                   4.2e-19, 29.82% id in 342 aa, and to Mycobacterium
FT                   smegmatis FxtD SWALL:O87315 (EMBL:AF027770) (420 aa) fasta
FT                   scores: E(): 2.7e-12, 31.09% id in 238 aa"
FT                   /protein_id="CAD66754.1"
FT                   /translation="MFGRKLLGALVALSLLTGCFGGKGDSESSSVLSKVETVFGEVTIP
FT                   RPKGHDLRVVALGRADAEAALAVGIKPVAVLDAFNIGGKGVGPWAEGLFGDVKPTVMSF
FT                   STDGLNWEQIKAFKPDVILDVRSKNDEKTYKRLSQIAPTVYGPKNSKDYQPYQIPWRDQ
FT                   QRQVAKALGRVKEGEEAIKKTEKAIKDAQDPLYRGLKAALVVQRPSGYGVFAESTRQWD
FT                   LIRELGFTLEPRVTELFDGRHAGKDIPSGKLNLIDTDVIVVTVKRGIRKAANHNDPLIA
FT                   SLKASKEGRIIYGSDEFNLALIAGSVLSIPEAIKFLSDKLREIAKKLRNK"
     MFGRKLLGAL VALSLLTGCF GGKGDSESSS VLSKVETVFG EVTIPRPKGH DLRVVALGRA        60
     DAEAALAVGI KPVAVLDAFN IGGKGVGPWA EGLFGDVKPT VMSFSTDGLN WEQIKAFKPD       120
     VILDVRSKND EKTYKRLSQI APTVYGPKNS KDYQPYQIPW RDQQRQVAKA LGRVKEGEEA       180
     IKKTEKAIKD AQDPLYRGLK AALVVQRPSG YGVFAESTRQ WDLIRELGFT LEPRVTELFD       240
     GRHAGKDIPS GKLNLIDTDV IVVTVKRGIR KAANHNDPLI ASLKASKEGR IIYGSDEFNL       300
     ALIAGSVLSI PEAIKFLSDK LREIAKKLRN K                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page