(data stored in ACNUC30630 zone)

EMBL: BX251410.PE63

BX251410.PE63        Location/Qualifiers
FT   CDS             complement(59134..59919)
FT                   /transl_table=11
FT                   /locus_tag="TW068"
FT                   /product="putative iron-siderophore uptake system
FT                   ATP-binding component"
FT                   /note="Similar to Escherichia coli ferric enterobactin
FT                   transport ATP-binding protein FepC or b0588
FT                   SWALL:FEPC_ECOLI (SWALL:P23878) (271 aa) fasta scores: E():
FT                   8.6e-42, 50% id in 250 aa"
FT                   /protein_id="CAD66755.1"
FT                   /translation="MITVDKLSFSYGKNKVLHDISIEIKRGSFIAIIGANGCGKSTFLR
FT                   SIAGLNRFEGDILLDKQHIRRLKPKNLAKHIAFLPQQVNLPEGLTIADLVSRGRYPHQS
FT                   ILHRWTKTDEEVVKESLQAVQASHISQRAIEAVSGGQRQRALIAMVLAQQTRILLLDEP
FT                   TTFLDIAYQYEILELLASLNRESKTIICSLHDLNQAARYASHLFVMGEGRIIASGEPKK
FT                   VITENLIENAFGLKSRIIDDPESNTPMIIPRKSENLKRL"
     MITVDKLSFS YGKNKVLHDI SIEIKRGSFI AIIGANGCGK STFLRSIAGL NRFEGDILLD        60
     KQHIRRLKPK NLAKHIAFLP QQVNLPEGLT IADLVSRGRY PHQSILHRWT KTDEEVVKES       120
     LQAVQASHIS QRAIEAVSGG QRQRALIAMV LAQQTRILLL DEPTTFLDIA YQYEILELLA       180
     SLNRESKTII CSLHDLNQAA RYASHLFVMG EGRIIASGEP KKVITENLIE NAFGLKSRII       240
     DDPESNTPMI IPRKSENLKR L                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page