(data stored in ACNUC30630 zone)

EMBL: BX251410.PE65

BX251410.PE65        Location/Qualifiers
FT   CDS             complement(60943..61908)
FT                   /transl_table=11
FT                   /locus_tag="TW070"
FT                   /product="putative iron-siderophore uptake system integral
FT                   membrane component"
FT                   /note="Similar to Escherichia coli ferric enterobactin
FT                   transport system permease protein FepD or b0590
FT                   SWALL:FEPD_ECOLI (SWALL:P23876) (334 aa) fasta scores: E():
FT                   5.2e-33, 40% id in 305 aa"
FT                   /protein_id="CAD66757.1"
FT                   /translation="MAGPVFRLSLVFGSVVIVGLCYLALFLDGSSVGQLIDAVFGGGDD
FT                   FKDVVLRDFRVPRILLAILVGAALSVAGAIMQVVTRNPLADPGLLGITHGAYLAIVLGF
FT                   LVGYVTPFWNLLIVPLLGASIAAGLVYFIGNIVTPGQLILVGVALTALISGLARSVALI
FT                   NQDIFDVIRHWAVGSLDYKKIDTVYISFPLILAGILIALMMMSSLNVLSIDKDISKSLG
FT                   VGKTALWSYIAVIALSAGSTAAVGPISFLALAAAHISRVISGPNLLRIIPLCLITGPIV
FT                   LLTADTLGRVLTPTGLDAGVVVPFLGAPILIFLSRKVKVF"
     MAGPVFRLSL VFGSVVIVGL CYLALFLDGS SVGQLIDAVF GGGDDFKDVV LRDFRVPRIL        60
     LAILVGAALS VAGAIMQVVT RNPLADPGLL GITHGAYLAI VLGFLVGYVT PFWNLLIVPL       120
     LGASIAAGLV YFIGNIVTPG QLILVGVALT ALISGLARSV ALINQDIFDV IRHWAVGSLD       180
     YKKIDTVYIS FPLILAGILI ALMMMSSLNV LSIDKDISKS LGVGKTALWS YIAVIALSAG       240
     STAAVGPISF LALAAAHISR VISGPNLLRI IPLCLITGPI VLLTADTLGR VLTPTGLDAG       300
     VVVPFLGAPI LIFLSRKVKV F                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page