(data stored in ACNUC30630 zone)

EMBL: BX251410.PE69

BX251410.PE69        Location/Qualifiers
FT   CDS             65832..67328
FT                   /transl_table=11
FT                   /locus_tag="TW074"
FT                   /product="putative phospholipase"
FT                   /note="Similar to Escherichia coli cardiolipin synthetase
FT                   Cls or Nov or b1249 SWALL:CLS_ECOLI (SWALL:P31071) (486 aa)
FT                   fasta scores: E(): 4.9e-21, 30.64% id in 496 aa"
FT                   /protein_id="CAD66761.1"
FT                   /translation="MKPYLFILAALLLADLVIRIGCLFVVPRNRRPNSANAWLLTIFFL
FT                   PFIGWFLFLIIGSYKLPKSRREKQALINQLVANALSDHAVLDNVDLQWLPSLVKLNRNL
FT                   GSMPMVAGTRVHILTDTSVIMEQMVSAIDSAKSSVHVEFYIFSLDEFTQGFFTSLENAT
FT                   ARGVKVRVLYDHIATLRVPGYLNMKSRLKRNGIEFYPMLPIQPFKLKYQRPDLRNHRKL
FT                   LVIDDAIAFVGSLNIIDPFYNTRGRKKMFWQDAMLRLEGPVISGISAVFVSDWYAETGQ
FT                   LLRDYRIVKTSSGDSFTENRTQSNSVDRSCPSTNNVLCQVVPSGPGFEGENNLQLFLML
FT                   LYASQKRVAITSPYFVPDEAMTLAIVSATKRGVSVELFLSENHDQKIVYHAQCSYYEQL
FT                   LRSGVKIWLYRAPNFLHSKYVTVDDDVAVFGSSNFDMRSFNLNMEMSLLLYSKEFVAKL
FT                   QAVEQENRANSSLLTLDEWMHRGKMDRLKDNLARLTSALQ"
     MKPYLFILAA LLLADLVIRI GCLFVVPRNR RPNSANAWLL TIFFLPFIGW FLFLIIGSYK        60
     LPKSRREKQA LINQLVANAL SDHAVLDNVD LQWLPSLVKL NRNLGSMPMV AGTRVHILTD       120
     TSVIMEQMVS AIDSAKSSVH VEFYIFSLDE FTQGFFTSLE NATARGVKVR VLYDHIATLR       180
     VPGYLNMKSR LKRNGIEFYP MLPIQPFKLK YQRPDLRNHR KLLVIDDAIA FVGSLNIIDP       240
     FYNTRGRKKM FWQDAMLRLE GPVISGISAV FVSDWYAETG QLLRDYRIVK TSSGDSFTEN       300
     RTQSNSVDRS CPSTNNVLCQ VVPSGPGFEG ENNLQLFLML LYASQKRVAI TSPYFVPDEA       360
     MTLAIVSATK RGVSVELFLS ENHDQKIVYH AQCSYYEQLL RSGVKIWLYR APNFLHSKYV       420
     TVDDDVAVFG SSNFDMRSFN LNMEMSLLLY SKEFVAKLQA VEQENRANSS LLTLDEWMHR       480
     GKMDRLKDNL ARLTSALQ                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page