(data stored in ACNUC30630 zone)

EMBL: BX251410.PE7

BX251410.PE7         Location/Qualifiers
FT   CDS             8894..9274
FT                   /transl_table=11
FT                   /locus_tag="TW007"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative integral
FT                   membrane protein SCO3872 or SCH18.09c SWALL:Q9KXX6
FT                   (EMBL:AL357152) (185 aa) fasta scores: E(): 0.0026, 30.5%
FT                   id in 118 aa"
FT                   /protein_id="CAD66699.1"
FT                   /translation="MNTKLVKSSSSQAVLRLGSINVVSAARTAFVFSLAFSVVMFLLIL
FT                   MLYMFLNFAGVFNISAVGGTPEGAPADFTLSNAISPWTVLIFSLILAGTNVFTFTTGAI
FT                   IFSVIYNVIARITGGLRFTFYR"
     MNTKLVKSSS SQAVLRLGSI NVVSAARTAF VFSLAFSVVM FLLILMLYMF LNFAGVFNIS        60
     AVGGTPEGAP ADFTLSNAIS PWTVLIFSLI LAGTNVFTFT TGAIIFSVIY NVIARITGGL       120
     RFTFYR                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page