(data stored in ACNUC30630 zone)

EMBL: BX251410.PE70

BX251410.PE70        Location/Qualifiers
FT   CDS             67380..69902
FT                   /transl_table=11
FT                   /locus_tag="TW075"
FT                   /product="putative Clp-family ATP-binding
FT                   protease/regulator"
FT                   /note="Similar to Bacillus subtilis negative regulator of
FT                   genetic competence ClpC/MecB SWALL:CLPC_BACSU
FT                   (SWALL:P37571) (810 aa) fasta scores: E(): 3e-152, 56.66%
FT                   id in 810 aa, and to Streptomyces coelicolor putative
FT                   Vlp-family ATP-binding protease SCO3373 or SCE94.24c
FT                   SWALL:Q9S6T8 (EMBL:AL049628) (841 aa) fasta scores: E():
FT                   7.6e-189, 65.87% id in 838 aa"
FT                   /protein_id="CAD66762.1"
FT                   /translation="MGEDMFERFTDKARRVIVLAQEEARTLSHNYIGTEHVLLGLISEG
FT                   DGIAAQALESLDITLERAREGVAELIGRGQNATSGHIPFTPRAKKVLELSLREALQLGH
FT                   NYIGTEHILLGILHEGEGIAAQVLVNMGAELPAIQQRVMHLLEDGREQEPVSVGPSESG
FT                   KISGSQILDQFGRHLTRAAKEGKLDPVIGREKEIERVMQVLSRRTKNNPILIGEPGVGK
FT                   TAVVEALAQAIVNGDVPVNLRNKQVYSLDLGSLIAGSRYRGDFEERLKKVTKEIRSRGD
FT                   IIVFIDEIHSLVGAGSAEGAIDAATILKPLLARGELQTIGATTLDEYRKNIEKDSALER
FT                   RFQPVNVSEPSIPMCIQILKGLRDRYEAHHKVKITDEAIYAAVTLSSRYINDRFLPDKA
FT                   IDLIDEAGARLRLSVLSNPSQLRAVEKKILAVVARKDKAVEKQDFDKVGELKRKEKALR
FT                   AELRKIKRDYENGNIASAGTVDEGLIAEVLASATGVPVFRLTEDESVRLMMMERSLHQR
FT                   VIGQDEAISSLSRAMRRTRAGLKDPNRPSGSFIFAGPTGVGKTELAKALAEFLFDNEDA
FT                   LVSLDMSEYGERHTVSRLFGAPPGFVGFEEGGQLTEKIRRKPFSVVLFDEIEKAHPDVF
FT                   NSLLQILEEGRLSDAQGRMVDFRNTIIVMTTNLGSRDIASGPVGFQSGDGSFLAYEAMK
FT                   AKVNEELRRSLKPEFLNRIDEVIVFPPLNRDELLQILKIFIKKLDDRLRDRTMRLSVTD
FT                   AALEQLVQIGYEPTMGARPLRRAVQREVEDRISEKILLGEIKPNQEIEMDFVNDNFTIV
FT                   SRDMDYPLSPLVPSVTTGLVTPDLASHV"
     MGEDMFERFT DKARRVIVLA QEEARTLSHN YIGTEHVLLG LISEGDGIAA QALESLDITL        60
     ERAREGVAEL IGRGQNATSG HIPFTPRAKK VLELSLREAL QLGHNYIGTE HILLGILHEG       120
     EGIAAQVLVN MGAELPAIQQ RVMHLLEDGR EQEPVSVGPS ESGKISGSQI LDQFGRHLTR       180
     AAKEGKLDPV IGREKEIERV MQVLSRRTKN NPILIGEPGV GKTAVVEALA QAIVNGDVPV       240
     NLRNKQVYSL DLGSLIAGSR YRGDFEERLK KVTKEIRSRG DIIVFIDEIH SLVGAGSAEG       300
     AIDAATILKP LLARGELQTI GATTLDEYRK NIEKDSALER RFQPVNVSEP SIPMCIQILK       360
     GLRDRYEAHH KVKITDEAIY AAVTLSSRYI NDRFLPDKAI DLIDEAGARL RLSVLSNPSQ       420
     LRAVEKKILA VVARKDKAVE KQDFDKVGEL KRKEKALRAE LRKIKRDYEN GNIASAGTVD       480
     EGLIAEVLAS ATGVPVFRLT EDESVRLMMM ERSLHQRVIG QDEAISSLSR AMRRTRAGLK       540
     DPNRPSGSFI FAGPTGVGKT ELAKALAEFL FDNEDALVSL DMSEYGERHT VSRLFGAPPG       600
     FVGFEEGGQL TEKIRRKPFS VVLFDEIEKA HPDVFNSLLQ ILEEGRLSDA QGRMVDFRNT       660
     IIVMTTNLGS RDIASGPVGF QSGDGSFLAY EAMKAKVNEE LRRSLKPEFL NRIDEVIVFP       720
     PLNRDELLQI LKIFIKKLDD RLRDRTMRLS VTDAALEQLV QIGYEPTMGA RPLRRAVQRE       780
     VEDRISEKIL LGEIKPNQEI EMDFVNDNFT IVSRDMDYPL SPLVPSVTTG LVTPDLASHV       840
//

If you have problems or comments...

PBIL Back to PBIL home page