(data stored in ACNUC30630 zone)

EMBL: BX251410.PE72

BX251410.PE72        Location/Qualifiers
FT   CDS             72230..72775
FT                   /transl_table=11
FT                   /locus_tag="TW079"
FT                   /product="putative secreted protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66764.1"
FT                   /translation="MKRVYLRRRIMLSMLIVLPLIVAVFFATGSPGHERPALPQPTPIK
FT                   VADDRCTEEQIAVFVTSDRESYTKNRLPAFRASVRNIGISPCRINVGTASQSYRIIRDG
FT                   KLIWDSKICLVDPTNALVMLLPKQTLTSQTLTWHREIANISDCGKDFSVRPKATPGEYT
FT                   VEFSIDGFSSSKYNFVLQ"
     MKRVYLRRRI MLSMLIVLPL IVAVFFATGS PGHERPALPQ PTPIKVADDR CTEEQIAVFV        60
     TSDRESYTKN RLPAFRASVR NIGISPCRIN VGTASQSYRI IRDGKLIWDS KICLVDPTNA       120
     LVMLLPKQTL TSQTLTWHRE IANISDCGKD FSVRPKATPG EYTVEFSIDG FSSSKYNFVL       180
     Q                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page