(data stored in ACNUC30630 zone)

EMBL: BX251410.PE76

BX251410.PE76        Location/Qualifiers
FT   CDS             complement(81523..82884)
FT                   /transl_table=11
FT                   /locus_tag="TW083"
FT                   /product="putative hydrolase"
FT                   /note="Similar to Synechocystis sp. serine esterase sll1284
FT                   SWALL:P73192 (EMBL:D90904) (204 aa) fasta scores: E():
FT                   0.0001, 29.01% id in 193 aa"
FT                   /protein_id="CAD66768.1"
FT                   /translation="MNNFDASAPIDECRVLGHVNENRFLLLAMHGYSGNNQVMYDTVKS
FT                   FMPQEIQAGISIVSLRAPIDLSSVSEGPDEGFAWFLFDESGSYKNSYKTLSQSAKQILS
FT                   WLDTKKPAGIGLLGFSQGGAMCMELLRAAPEKFDFAVNISGFVWGPPRRDDSVLAGGLE
FT                   KRVRYGDSLVTERRRTEVFWGLGKEDTILPYKVWEATQAWLLSVTNPEIRIYPELAHKI
FT                   CDEEVRDISSFLLRHLENRVGRITPAIRCRWKEQDLTGKNVVLLLHGYGSSESELIRWT
FT                   GPSAAQVSLDEQTEQYLPENTTYISLQGPIPEAMGYAWFDRNATDVGDAVNSVVNWFCD
FT                   LVQTFGKPARVGLLGFSQGGAVCIELLLRHPELFDLAVVLSGFAVGSTTSSAKKPVLWI
FT                   RGDSDSVIDENRVLSTKYVLEKSSELTEECLSGLTHEITPEVIARASKYLRAHL"
     MNNFDASAPI DECRVLGHVN ENRFLLLAMH GYSGNNQVMY DTVKSFMPQE IQAGISIVSL        60
     RAPIDLSSVS EGPDEGFAWF LFDESGSYKN SYKTLSQSAK QILSWLDTKK PAGIGLLGFS       120
     QGGAMCMELL RAAPEKFDFA VNISGFVWGP PRRDDSVLAG GLEKRVRYGD SLVTERRRTE       180
     VFWGLGKEDT ILPYKVWEAT QAWLLSVTNP EIRIYPELAH KICDEEVRDI SSFLLRHLEN       240
     RVGRITPAIR CRWKEQDLTG KNVVLLLHGY GSSESELIRW TGPSAAQVSL DEQTEQYLPE       300
     NTTYISLQGP IPEAMGYAWF DRNATDVGDA VNSVVNWFCD LVQTFGKPAR VGLLGFSQGG       360
     AVCIELLLRH PELFDLAVVL SGFAVGSTTS SAKKPVLWIR GDSDSVIDEN RVLSTKYVLE       420
     KSSELTEECL SGLTHEITPE VIARASKYLR AHL                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page