(data stored in ACNUC30630 zone)

EMBL: BX251410.PE8

BX251410.PE8         Location/Qualifiers
FT   CDS             complement(9640..10332)
FT                   /transl_table=11
FT                   /locus_tag="TW008"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Thermoanaerobacter tengcongensis thiamine
FT                   pyrophosphokinase Thi80 or Tte1497 SWALL:Q8R9T9
FT                   (EMBL:AE013107) (211 aa) fasta scores: E(): 2.5e-09, 29.68%
FT                   id in 192 aa, and to Bacillus subtilis YloS protein
FT                   SWALL:O34664 (EMBL:Z99112) (214 aa) fasta scores: E():
FT                   5.7e-08, 30% id in 210 aa"
FT                   /protein_id="CAD66700.1"
FT                   /translation="MLGMGVCYIYGAGEHFTPPEEVGMHDLVIAADGGLMQLKKHGARI
FT                   DLYVGDLDSIESIPINIDRVILPREKDKTDMMQAALIGAERGFRTFCIFGGTGGRLDHT
FT                   IGNIQLLAELTNMGYSVFIVGKYDVVTAIRNNEIYFPSHFTGNISIFPHSGDASGVYEE
FT                   GLKYALNNAHIPGTFNGVSNEFIGVKSRVAVESGMLLVVYERQGGRMHLNISTCAMTAG
FT                   NQIQKPSG"
     MLGMGVCYIY GAGEHFTPPE EVGMHDLVIA ADGGLMQLKK HGARIDLYVG DLDSIESIPI        60
     NIDRVILPRE KDKTDMMQAA LIGAERGFRT FCIFGGTGGR LDHTIGNIQL LAELTNMGYS       120
     VFIVGKYDVV TAIRNNEIYF PSHFTGNISI FPHSGDASGV YEEGLKYALN NAHIPGTFNG       180
     VSNEFIGVKS RVAVESGMLL VVYERQGGRM HLNISTCAMT AGNQIQKPSG                  230
//

If you have problems or comments...

PBIL Back to PBIL home page