(data stored in ACNUC30630 zone)

EMBL: BX251410.PE80

BX251410.PE80        Location/Qualifiers
FT   CDS             85986..86699
FT                   /transl_table=11
FT                   /locus_tag="TW087"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative membrane
FT                   protein SCO1829 or SCI8.14 SWALL:Q9RJ39 (EMBL:AL132644)
FT                   (290 aa) fasta scores: E(): 0.37, 25.79% id in 252 aa"
FT                   /protein_id="CAD66772.1"
FT                   /translation="MPKAYFKLSSLLLLAPFLVVSFCFVYLGFWQLSRSYSPQDDPGTG
FT                   IVTDFSVHTHILHGQRIALEGQLIPEDTLIVSDRYEKGESTWWLVARYNTPNGALPAVL
FT                   GYGDRNAVATACSHLKQTKVVASQKISGRFYYDEPPDSLKLPESGTLNRMSSAAMINMW
FT                   RKFSDPRVFSGFVVLDDPPGLGLGRVSILPGQPARINWLNIFYAVEWFLFAGFCLYVWF
FT                   YLVRTPEIESCAKRD"
     MPKAYFKLSS LLLLAPFLVV SFCFVYLGFW QLSRSYSPQD DPGTGIVTDF SVHTHILHGQ        60
     RIALEGQLIP EDTLIVSDRY EKGESTWWLV ARYNTPNGAL PAVLGYGDRN AVATACSHLK       120
     QTKVVASQKI SGRFYYDEPP DSLKLPESGT LNRMSSAAMI NMWRKFSDPR VFSGFVVLDD       180
     PPGLGLGRVS ILPGQPARIN WLNIFYAVEW FLFAGFCLYV WFYLVRTPEI ESCAKRD          237
//

If you have problems or comments...

PBIL Back to PBIL home page