(data stored in ACNUC30630 zone)

EMBL: BX251410.PE81

BX251410.PE81        Location/Qualifiers
FT   CDS             86765..87202
FT                   /transl_table=11
FT                   /locus_tag="TW088"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Corynebacterium glutamicum hypothetical
FT                   membrane protein Cgl2499 SWALL:BAB99892 (EMBL:AP005281)
FT                   (118 aa) fasta scores: E(): 0.0015, 31.53% id in 130 aa"
FT                   /protein_id="CAD66773.1"
FT                   /translation="MPKGSSEQEPVRQPVCPGDNSVLSAFRMYRAASSITGVLLILVCV
FT                   EMFLKYILGVQVFALTGGALVELYHVDAPEPSGLNLSVMTLIFHGWFYVFYLWSDLYLW
FT                   SKVRFGFALFIVIALGGVVPLMSFVVERYVYKKLSKRFVST"
     MPKGSSEQEP VRQPVCPGDN SVLSAFRMYR AASSITGVLL ILVCVEMFLK YILGVQVFAL        60
     TGGALVELYH VDAPEPSGLN LSVMTLIFHG WFYVFYLWSD LYLWSKVRFG FALFIVIALG       120
     GVVPLMSFVV ERYVYKKLSK RFVST                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page