(data stored in ACNUC30630 zone)

EMBL: BX251410.PE83

BX251410.PE83        Location/Qualifiers
FT   CDS             88815..91046
FT                   /transl_table=11
FT                   /locus_tag="TW090"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="Similar to Bacillus subtilis ATP-dependent DNA
FT                   helicase PcrA SWALL:PCRA_BACSU (SWALL:O34580) (739 aa)
FT                   fasta scores: E(): 1.1e-72, 41.42% id in 758 aa"
FT                   /protein_id="CAD66775.1"
FT                   /translation="MTIPADLLKGLNPQQVEGVCYRGPTLLISAGAGSGKTKVLTHRIA
FT                   GFLATGEASCDQILAITFTNKAASEMRHRTGDLVGLSVRDMQISTFHSVCVRILRECVG
FT                   HLGKAKNFTIYDAADQRAIIKQICQSTDTFGLTASMVASQIGLLKNQMHTPDTYSRCLA
FT                   SNSTNGNSVTSITLQREQFILHVFRRYQEILKEANAFDFDDLISETVFLLQKSPEISAM
FT                   YRNRWKYLLVDEYQDTNHAQYRLILELTKGDKSDMSLTAVGDSDQSIYAFRGADIANIV
FT                   NFENDFPDCHTILLEQNYRSCQNILLAANALISNNQNRKDKNLWSELGAGEKVVAYCAS
FT                   SAEEEGRFVADRVRHLVDQGESLSDIAVFYRSNTQSRAIEESLIRQSIPYRVVGGTKFY
FT                   ERAEIKDILAYLTVIVNPDDTLALRRILNVPKRGVGTVSENRLVEFASARGITLMQALS
FT                   RIDEINIQPSAKSALRDLFYLLNRFAGSSMPANELLDDLLKATDLLSRFNNTDDPQNEA
FT                   RKINIGDFVDSVEDFAKENPGGTLSDFMTNIALMTSYDQSDDAPGQITLMTLHMAKGLE
FT                   FDFVFLTGLEEGILPHEMSLKEKNGIEEERRLAYVGMTRAKKVLHLSFSSYRKRYTDGV
FT                   RLPSRFWDEIPQHLLRWHSRFTHKRFTGPLYGFTARPAGESRQSVHVLKDRYPRESFSI
FT                   SDSVKHSVFGVGTVVDVLGLGPKQIIVVEFADKRRSLLASIAPIVKCKQ"
     MTIPADLLKG LNPQQVEGVC YRGPTLLISA GAGSGKTKVL THRIAGFLAT GEASCDQILA        60
     ITFTNKAASE MRHRTGDLVG LSVRDMQIST FHSVCVRILR ECVGHLGKAK NFTIYDAADQ       120
     RAIIKQICQS TDTFGLTASM VASQIGLLKN QMHTPDTYSR CLASNSTNGN SVTSITLQRE       180
     QFILHVFRRY QEILKEANAF DFDDLISETV FLLQKSPEIS AMYRNRWKYL LVDEYQDTNH       240
     AQYRLILELT KGDKSDMSLT AVGDSDQSIY AFRGADIANI VNFENDFPDC HTILLEQNYR       300
     SCQNILLAAN ALISNNQNRK DKNLWSELGA GEKVVAYCAS SAEEEGRFVA DRVRHLVDQG       360
     ESLSDIAVFY RSNTQSRAIE ESLIRQSIPY RVVGGTKFYE RAEIKDILAY LTVIVNPDDT       420
     LALRRILNVP KRGVGTVSEN RLVEFASARG ITLMQALSRI DEINIQPSAK SALRDLFYLL       480
     NRFAGSSMPA NELLDDLLKA TDLLSRFNNT DDPQNEARKI NIGDFVDSVE DFAKENPGGT       540
     LSDFMTNIAL MTSYDQSDDA PGQITLMTLH MAKGLEFDFV FLTGLEEGIL PHEMSLKEKN       600
     GIEEERRLAY VGMTRAKKVL HLSFSSYRKR YTDGVRLPSR FWDEIPQHLL RWHSRFTHKR       660
     FTGPLYGFTA RPAGESRQSV HVLKDRYPRE SFSISDSVKH SVFGVGTVVD VLGLGPKQII       720
     VVEFADKRRS LLASIAPIVK CKQ                                               743
//

If you have problems or comments...

PBIL Back to PBIL home page