(data stored in ACNUC30630 zone)

EMBL: BX251410.PE84

BX251410.PE84        Location/Qualifiers
FT   CDS             91313..92797
FT                   /transl_table=11
FT                   /locus_tag="TW092"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66776.1"
FT                   /translation="MKVLPLLFVTALDACFAVVTPILIPLVVLLVSWIFSDNLYGPFSY
FT                   RLEGALAIWGAGFGVPVRVLRPLEFSVSIIPLSMTLVTMLISLRLARRCVLFGRRILLF
FT                   VIASIAYVITAMVILSFVHWELVTLDPVKVIFFGLFLYISFALLASEILINRNHSRIVT
FT                   PIIRLHAPKWLRELAGLSMRCAIMLLLLQLSLASMVFAGLQFLHTFDTVQIYNSMHAGI
FT                   VGLISITLLQLAFLPNFLIWIISWQVGAGFYIGGLHFGGFSIDHGDYSLPLVPVFASLP
FT                   AQNFPLMGNIILTTVCVIPVGIWLMKNRSISFSFGWKLVIGFSGVVLATLSLVFLSYLS
FT                   GGSISPRQSVGIDLLLLFLLSFADIFCGVLVGVVIGIIFKPYTAYERIKTPRVWEYLGH
FT                   LPSRASSLLPIFGRPNANKAPVNKVSVSKTTELNTGNTPETSGRSVFTAVYFWRTICRV
FT                   CHVKRLWGKQSKVDPAIKGKSRNKPGLGVPRMKDLE"
     MKVLPLLFVT ALDACFAVVT PILIPLVVLL VSWIFSDNLY GPFSYRLEGA LAIWGAGFGV        60
     PVRVLRPLEF SVSIIPLSMT LVTMLISLRL ARRCVLFGRR ILLFVIASIA YVITAMVILS       120
     FVHWELVTLD PVKVIFFGLF LYISFALLAS EILINRNHSR IVTPIIRLHA PKWLRELAGL       180
     SMRCAIMLLL LQLSLASMVF AGLQFLHTFD TVQIYNSMHA GIVGLISITL LQLAFLPNFL       240
     IWIISWQVGA GFYIGGLHFG GFSIDHGDYS LPLVPVFASL PAQNFPLMGN IILTTVCVIP       300
     VGIWLMKNRS ISFSFGWKLV IGFSGVVLAT LSLVFLSYLS GGSISPRQSV GIDLLLLFLL       360
     SFADIFCGVL VGVVIGIIFK PYTAYERIKT PRVWEYLGHL PSRASSLLPI FGRPNANKAP       420
     VNKVSVSKTT ELNTGNTPET SGRSVFTAVY FWRTICRVCH VKRLWGKQSK VDPAIKGKSR       480
     NKPGLGVPRM KDLE                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page