(data stored in ACNUC30630 zone)

EMBL: BX251410.PE87

BX251410.PE87        Location/Qualifiers
FT   CDS             complement(95180..95521)
FT                   /transl_table=11
FT                   /locus_tag="TW095"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66779.1"
FT                   /translation="MKSMNKKLAVFLLARDLSFVLSATILEVWCLSSVTWPVNAIFGVV
FT                   LPIVLGLGWACILSTSPAISASIYLRSIVYLVVSLLAALSLIDFRSIGLAVAHLVLASF
FT                   IGFVLVLLD"
     MKSMNKKLAV FLLARDLSFV LSATILEVWC LSSVTWPVNA IFGVVLPIVL GLGWACILST        60
     SPAISASIYL RSIVYLVVSL LAALSLIDFR SIGLAVAHLV LASFIGFVLV LLD              113
//

If you have problems or comments...

PBIL Back to PBIL home page