(data stored in ACNUC30630 zone)

EMBL: BX251410.PE9

BX251410.PE9         Location/Qualifiers
FT   CDS             10472..11095
FT                   /transl_table=11
FT                   /locus_tag="TW009"
FT                   /product="putative integral membrane protein"
FT                   /note="Similar to Streptomyces coelicolor putative membrane
FT                   protein SCO3855 or SCH69.25c SWALL:Q9XA09 (EMBL:AL079308)
FT                   (297 aa) fasta scores: E(): 9.4e-13, 40% id in 155 aa"
FT                   /protein_id="CAD66701.1"
FT                   /translation="MIIWRRLRAYPPATATIITLCIFLWLLQMLLGSGVTTSLAFAGAY
FT                   VFPDSLQPWRIFTSMFLHSTFTPLHLLFNMYSLWWLGSNLEQRIGSWRFLALYFISGLG
FT                   AAVGIVYLQPYNTLTLGASGGIFGLLAAFIVLRIDSGQLWGIVGLNLIISFLLPGVSWQ
FT                   AHIGGLLSGFVAAWAIKRRNPLLLGAQVILLIGVIATRPYLLYA"
     MIIWRRLRAY PPATATIITL CIFLWLLQML LGSGVTTSLA FAGAYVFPDS LQPWRIFTSM        60
     FLHSTFTPLH LLFNMYSLWW LGSNLEQRIG SWRFLALYFI SGLGAAVGIV YLQPYNTLTL       120
     GASGGIFGLL AAFIVLRIDS GQLWGIVGLN LIISFLLPGV SWQAHIGGLL SGFVAAWAIK       180
     RRNPLLLGAQ VILLIGVIAT RPYLLYA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page