(data stored in ACNUC30630 zone)

EMBL: BX251410.PE90

BX251410.PE90        Location/Qualifiers
FT   CDS             97781..98905
FT                   /transl_table=11
FT                   /locus_tag="TW098"
FT                   /product="putative metalloprotease"
FT                   /note="Similar to Mycobacterium tuberculosis hypothetical
FT                   zinc metalloprotease Rv2869c or mt2937 or mtv003.15C
FT                   SWALL:YS69_MYCTU (SWALL:O33351) (404 aa) fasta scores: E():
FT                   8.7e-11, 34.51% id in 423 aa"
FT                   /protein_id="CAD66782.1"
FT                   /translation="MFFLGVLIILIFVYIAVALHELGHMLPAKYFGVPVQKYAIGFGPS
FT                   LFSFKKRETSYSFNLLPLGGYVQLEGMLPPSENPRRWFKKLMKFAESDSPRAFWRLPAW
FT                   KKIIVMFSGPFVNLILATLGYVFVLSVLGLPVIKPVIHEVIANTPAASAGILPGDEIIA
FT                   INDTAISSPGQIRGLIQDKDLVTLSLLKDGGTRIVSLRPLNGSIGVKFSTVNERQSIFD
FT                   ALSSMVKDTVGVAKSLIALPYNLFTGLADTLHQRKDGVVGLIGAARISGDIVSAPSISL
FT                   YDKLRSMIWIFASLNLALFVFNMIPLLPFDGGYIAAAVFEGARSRVLLAFRKNDYAPVN
FT                   ISYLLPVTLLVTAAIIVMSIMLAWIDIVNPLRLG"
     MFFLGVLIIL IFVYIAVALH ELGHMLPAKY FGVPVQKYAI GFGPSLFSFK KRETSYSFNL        60
     LPLGGYVQLE GMLPPSENPR RWFKKLMKFA ESDSPRAFWR LPAWKKIIVM FSGPFVNLIL       120
     ATLGYVFVLS VLGLPVIKPV IHEVIANTPA ASAGILPGDE IIAINDTAIS SPGQIRGLIQ       180
     DKDLVTLSLL KDGGTRIVSL RPLNGSIGVK FSTVNERQSI FDALSSMVKD TVGVAKSLIA       240
     LPYNLFTGLA DTLHQRKDGV VGLIGAARIS GDIVSAPSIS LYDKLRSMIW IFASLNLALF       300
     VFNMIPLLPF DGGYIAAAVF EGARSRVLLA FRKNDYAPVN ISYLLPVTLL VTAAIIVMSI       360
     MLAWIDIVNP LRLG                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page