(data stored in ACNUC30630 zone)

EMBL: BX251410.PE92

BX251410.PE92        Location/Qualifiers
FT   CDS             100065..100817
FT                   /transl_table=11
FT                   /locus_tag="TW100"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical
FT                   protein SCO3845 or SCH69.15 SWALL:Q9XA19 (EMBL:AL079308)
FT                   (515 aa) fasta scores: E(): 5.4e-22, 35.98% id in 239 aa,
FT                   and to Rhizobium loti probable phosphoprotein phosphatase
FT                   mlr2361 SWALL:Q98IK3 (EMBL:AP002999) (280 aa) fasta scores:
FT                   E(): 1.4e-20, 36.08% id in 230 aa"
FT                   /protein_id="CAD66784.1"
FT                   /translation="MSNRSTGSDDYIVSGKFSISWASLSHVGHHRESNEDSYSAKPPLW
FT                   VVADGMGGHACGDIASGVVTSFLSAISSDFVSPQDITGALRQALASLAKKIGSTTAGTT
FT                   LSGIGLSKVDNQPAWLVLNLGDSRVYCIESDKIRLLTEDHSIVHEMIKSGQITPEEAAI
FT                   HPYNNIITRAVSFNSEPIPDFSFLPLRSGVRFIICSDGLTKELNDAQIETHATRGSPRE
FT                   AAESLLYAALSAGGRDNITIILLDVHDK"
     MSNRSTGSDD YIVSGKFSIS WASLSHVGHH RESNEDSYSA KPPLWVVADG MGGHACGDIA        60
     SGVVTSFLSA ISSDFVSPQD ITGALRQALA SLAKKIGSTT AGTTLSGIGL SKVDNQPAWL       120
     VLNLGDSRVY CIESDKIRLL TEDHSIVHEM IKSGQITPEE AAIHPYNNII TRAVSFNSEP       180
     IPDFSFLPLR SGVRFIICSD GLTKELNDAQ IETHATRGSP REAAESLLYA ALSAGGRDNI       240
     TIILLDVHDK                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page