(data stored in ACNUC30630 zone)

EMBL: BX251410.PE93

BX251410.PE93        Location/Qualifiers
FT   CDS             complement(100840..102411)
FT                   /transl_table=11
FT                   /locus_tag="TW101"
FT                   /product="conserved hypothetical protein (putative
FT                   ATP-binding)"
FT                   /note="Weakly similar to Methanosarcina acetivorans
FT                   hypothetical protein Ma1866 SWALL:Q8TPP0 (EMBL:AE010868)
FT                   (613 aa) fasta scores: E(): 0.0012, 22.1% id in 579 aa"
FT                   /protein_id="CAD66785.1"
FT                   /translation="MQLKQVTITNYTPISDITLEVRRHLVLVGANDSGKTSILTCLDLL
FT                   LSATTPMLYSHFQAWHFRDATKPIIISVDINNLDDKIQIAFGINNNRISEIKLTLSAFL
FT                   DESQMLTIKREVLYNNTTKPVADSQLTGIGWELFDAGEVPCTASQYKTVLSGVMESTNL
FT                   RQHGLSSLTQSFREQIEASPFLENLRERLAEKLIKTMPGNLNKDAVHLVPKDDIGTQVL
FT                   GNIRVQVKRQNKSPHMIDCLDGMRSLYAVAIYDVLSRDASVVGIDEPETHLHPTIQRSL
FT                   ARVLQEESNQKIIATHSADIVGAFSPEHVAVVQPNGQVVQPARGFLGEDERIIARWWVH
FT                   GRLEPLTARRIVAVEGISDRIILESAAEVTGRNLDRLGIALIEANGSGDMWPIYKLFGP
FT                   KGFRIPISLLIDSDAVQHTSVRLGIPKNEFTQNSIYVSKRDLEDEYTRAIGANTLWNAL
FT                   RESKLFAHSELRGGGKTEQAVAAFCRKNSSNKVRAALVVSSLLNEQLAIAIESVNSLLN
FT                   AIELPR"
     MQLKQVTITN YTPISDITLE VRRHLVLVGA NDSGKTSILT CLDLLLSATT PMLYSHFQAW        60
     HFRDATKPII ISVDINNLDD KIQIAFGINN NRISEIKLTL SAFLDESQML TIKREVLYNN       120
     TTKPVADSQL TGIGWELFDA GEVPCTASQY KTVLSGVMES TNLRQHGLSS LTQSFREQIE       180
     ASPFLENLRE RLAEKLIKTM PGNLNKDAVH LVPKDDIGTQ VLGNIRVQVK RQNKSPHMID       240
     CLDGMRSLYA VAIYDVLSRD ASVVGIDEPE THLHPTIQRS LARVLQEESN QKIIATHSAD       300
     IVGAFSPEHV AVVQPNGQVV QPARGFLGED ERIIARWWVH GRLEPLTARR IVAVEGISDR       360
     IILESAAEVT GRNLDRLGIA LIEANGSGDM WPIYKLFGPK GFRIPISLLI DSDAVQHTSV       420
     RLGIPKNEFT QNSIYVSKRD LEDEYTRAIG ANTLWNALRE SKLFAHSELR GGGKTEQAVA       480
     AFCRKNSSNK VRAALVVSSL LNEQLAIAIE SVNSLLNAIE LPR                         523
//

If you have problems or comments...

PBIL Back to PBIL home page