(data stored in ACNUC30630 zone)

EMBL: BX251410.PE94

BX251410.PE94        Location/Qualifiers
FT   CDS             102673..102936
FT                   /transl_table=11
FT                   /locus_tag="TW103"
FT                   /product="putative membrane protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /protein_id="CAD66786.1"
FT                   /translation="MAACLFLAVLLTLRPILHPGFLLVPSDTIFGGLWLLTFVVGLIGV
FT                   IYFMHMLIFTPLCDKVDHMEYTANFGVLDLATSHVKYQCGRR"
     MAACLFLAVL LTLRPILHPG FLLVPSDTIF GGLWLLTFVV GLIGVIYFMH MLIFTPLCDK        60
     VDHMEYTANF GVLDLATSHV KYQCGRR                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page