(data stored in ACNUC30630 zone)

EMBL: BX251410.PE95

BX251410.PE95        Location/Qualifiers
FT   CDS             102921..103964
FT                   /transl_table=11
FT                   /locus_tag="TW104"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66787.1"
FT                   /translation="MWEKIADLRRSLTLSGVFFVYFTRKVFSYRLGLSSRMFILGICVL
FT                   LYGTVLIYRLSLLAPVFYDFVTLIGAAESIINLFMAFLFAKILFLRSGGLMNFTMQLPL
FT                   KNKERTMALTICEILIVFMGFTILYSPEAIVSTWKTGQPAYLLVNGLMPGFIAYILCSL
FT                   IYNLSVRIFILFNLSRLSHIGGIIVTIFAFLGLLIFVGQSVQSLLPAPGQSIKQAYDHL
FT                   QTDVFLIFNVFFWLFQHYGLLTSILAFLISLIILFPALIISIPSKYPDVHRFIKFPVPF
FT                   INSTLWPFIAVFIRRIEWWVAVVVSILSIPLGGFVLILLNLHLLALFSAGIYMFSMSRA
FT                   IRTATWI"
     MWEKIADLRR SLTLSGVFFV YFTRKVFSYR LGLSSRMFIL GICVLLYGTV LIYRLSLLAP        60
     VFYDFVTLIG AAESIINLFM AFLFAKILFL RSGGLMNFTM QLPLKNKERT MALTICEILI       120
     VFMGFTILYS PEAIVSTWKT GQPAYLLVNG LMPGFIAYIL CSLIYNLSVR IFILFNLSRL       180
     SHIGGIIVTI FAFLGLLIFV GQSVQSLLPA PGQSIKQAYD HLQTDVFLIF NVFFWLFQHY       240
     GLLTSILAFL ISLIILFPAL IISIPSKYPD VHRFIKFPVP FINSTLWPFI AVFIRRIEWW       300
     VAVVVSILSI PLGGFVLILL NLHLLALFSA GIYMFSMSRA IRTATWI                     347
//

If you have problems or comments...

PBIL Back to PBIL home page