(data stored in ACNUC30630 zone)

EMBL: BX251410.PE97

BX251410.PE97        Location/Qualifiers
FT   CDS             104352..105071
FT                   /transl_table=11
FT                   /locus_tag="TW106"
FT                   /product="putative ABC transport ATP-binding subunit"
FT                   /note="Similar to Myxococcus xanthus PilH SWALL:O30385
FT                   (EMBL:AF003632) (326 aa) fasta scores: E(): 1.1e-12, 33.49%
FT                   id in 206 aa, and to Streptomyces coelicolor putative ABC
FT                   transporter ATP-binding protein SCO3633 or SCH10.11
FT                   SWALL:Q9X8Q0 (EMBL:AL049754) (311 aa) fasta scores: E():
FT                   2.3e-11, 29.61% id in 233 aa"
FT                   /protein_id="CAD66789.1"
FT                   /translation="MNILSVQDVSFSYDKSTPAIYGVDLQIDPGEVVGLVGPNGSGKST
FT                   FIKLVFDLLELQKGQIQILGNNHRLTTARLASIYLPSDDDLPEFLTGDEYLRTLFRLYK
FT                   RPFDKNSVLREFDRFGMRGRERNLIEDYSHGMRKKLQLISAFLLQLPLTVIDETINGID
FT                   LDAVYECRKSITELKSRGHSVLLCTHDFYFLQKVADKVIVFHQAKQIASFATPSHEHLE
FT                   DRVAEILGVDLHDRGAL"
     MNILSVQDVS FSYDKSTPAI YGVDLQIDPG EVVGLVGPNG SGKSTFIKLV FDLLELQKGQ        60
     IQILGNNHRL TTARLASIYL PSDDDLPEFL TGDEYLRTLF RLYKRPFDKN SVLREFDRFG       120
     MRGRERNLIE DYSHGMRKKL QLISAFLLQL PLTVIDETIN GIDLDAVYEC RKSITELKSR       180
     GHSVLLCTHD FYFLQKVADK VIVFHQAKQI ASFATPSHEH LEDRVAEILG VDLHDRGAL        239
//

If you have problems or comments...

PBIL Back to PBIL home page