(data stored in ACNUC30630 zone)

EMBL: BX251410.PE98

BX251410.PE98        Location/Qualifiers
FT   CDS             105068..105424
FT                   /transl_table=11
FT                   /locus_tag="TW107"
FT                   /product="putative integral membrane protein"
FT                   /note="No significant database matches"
FT                   /protein_id="CAD66790.1"
FT                   /translation="MTQAFSRRSPFRKIKLVTAILSSSFALSMITVFVSFMYLVAITDP
FT                   SSGVEQYHSLIFNTIYIRTEPSSKGVHIDISVGLLAVILPFLFFTIIISLCVFFYKKFI
FT                   KNKKTTKSKKLPLK"
     MTQAFSRRSP FRKIKLVTAI LSSSFALSMI TVFVSFMYLV AITDPSSGVE QYHSLIFNTI        60
     YIRTEPSSKG VHIDISVGLL AVILPFLFFT IIISLCVFFY KKFIKNKKTT KSKKLPLK         118
//

If you have problems or comments...

PBIL Back to PBIL home page