(data stored in ACNUC30630 zone)

EMBL: BX251410.PE99

BX251410.PE99        Location/Qualifiers
FT   CDS             complement(107600..108649)
FT                   /transl_table=11
FT                   /locus_tag="TW108"
FT                   /product="putative DNA recombinase"
FT                   /note="Similar to Corynebacterium glutamicum integrase
FT                   Cgl1419 SWALL:BAB98812 (EMBL:AP005278) (304 aa) fasta
FT                   scores: E(): 6.6e-16, 38.73% id in 333 aa, and to
FT                   Pseudomonas aeruginosa integrase Inti1 SWALL:Q9AIL0
FT                   (EMBL:AF263519) (337 aa) fasta scores: E(): 4.4e-12, 28.75%
FT                   id in 306 aa"
FT                   /protein_id="CAD66791.1"
FT                   /translation="MSKNTVTKVADIAIPPDIKPDFDWFFPFAKLELGLSDATLQTYRN
FT                   SLGIYLSWLGEQGTQRLSEVNSNAIERFLEYRQRHTRKSTLANTVAALRTFHRHLVLEG
FT                   RQALNPTEKLQQPKVPKALPHPLSLDEIINLLKAADANQAREISLRDRALIEVLYGTGA
FT                   RISEAVSLNVNAFAESDQNLLRLTGKGNKQRMVLFGSYARNAVDNYLQHSRPKLLARSH
FT                   VYRNITDASTLKYRPTSSTIGDAEDGVLTATAAGVPWLFLSNRGKRLTRQQAGNIIRKL
FT                   GEAAEIGRYISPHSLRHSFATHMLQAGADIRTVQELLGHSSINTTSVYTKVTIDSLREV
FT                   YTTSHPRAL"
     MSKNTVTKVA DIAIPPDIKP DFDWFFPFAK LELGLSDATL QTYRNSLGIY LSWLGEQGTQ        60
     RLSEVNSNAI ERFLEYRQRH TRKSTLANTV AALRTFHRHL VLEGRQALNP TEKLQQPKVP       120
     KALPHPLSLD EIINLLKAAD ANQAREISLR DRALIEVLYG TGARISEAVS LNVNAFAESD       180
     QNLLRLTGKG NKQRMVLFGS YARNAVDNYL QHSRPKLLAR SHVYRNITDA STLKYRPTSS       240
     TIGDAEDGVL TATAAGVPWL FLSNRGKRLT RQQAGNIIRK LGEAAEIGRY ISPHSLRHSF       300
     ATHMLQAGAD IRTVQELLGH SSINTTSVYT KVTIDSLREV YTTSHPRAL                   349
//

If you have problems or comments...

PBIL Back to PBIL home page