(data stored in ACNUC30630 zone)

EMBL: BX251410.PUNA

BX251410.PUNA        Location/Qualifiers
FT   CDS             complement(18061..18894)
FT                   /transl_table=11
FT                   /gene="punA"
FT                   /locus_tag="TW018"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="Similar to Cellulomonas sp purine nucleoside
FT                   phosphorylase PunA SWALL:PUNA_CELSP (SWALL:P81989) (282 aa)
FT                   fasta scores: E(): 6.6e-45, 48.33% id in 271 aa"
FT                   /protein_id="CAD66710.1"
FT                   /translation="MEDICNTELTAATLAAKQIADITGIARHDIAVTLGSGWVDAVSNL
FT                   GELITTIPAQDIHGFFPPVLAGHSGVLTSIRLTCGVYVLVIGARTHLYQGHGPEAVVHG
FT                   IKTAHAAGARVAILTNGAGSTVPDWGPGEVVVIKDHINLTGKSPLSGANFCDMSDIYTA
FT                   ALRQKILQMAPNIPQGVYAQMPGPQYETPAEVKMLRTIGADLVGMSTALEAIMAKSLKM
FT                   NVVGLSLVTNLAAGIGTGQLSHDEVLTVSEQARQKTSAFLVELIRDIGQDLSGRK"
     MEDICNTELT AATLAAKQIA DITGIARHDI AVTLGSGWVD AVSNLGELIT TIPAQDIHGF        60
     FPPVLAGHSG VLTSIRLTCG VYVLVIGART HLYQGHGPEA VVHGIKTAHA AGARVAILTN       120
     GAGSTVPDWG PGEVVVIKDH INLTGKSPLS GANFCDMSDI YTAALRQKIL QMAPNIPQGV       180
     YAQMPGPQYE TPAEVKMLRT IGADLVGMST ALEAIMAKSL KMNVVGLSLV TNLAAGIGTG       240
     QLSHDEVLTV SEQARQKTSA FLVELIRDIG QDLSGRK                                277
//

If you have problems or comments...

PBIL Back to PBIL home page