(data stored in ACNUC30630 zone)

EMBL: BX251410.PURC

BX251410.PURC        Location/Qualifiers
FT   CDS             complement(126672..127589)
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="TW119"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="Similar to Streptomyces coelicolor
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   PurC or SCO4071 or SCD25.07 SWALL:Q9RKL1 (EMBL:AL118514)
FT                   (299 aa) fasta scores: E(): 1e-38, 40.64% id in 310 aa, and
FT                   to Mycobacterium tuberculosis
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   PurC or Rv0780 or mt0804 or mtcy369.24 SWALL:PUR7_MYCTU
FT                   (SWALL:Q59566) (297 aa) fasta scores: E(): 1.6e-28, 38.19%
FT                   id in 288 aa"
FT                   /db_xref="GOA:Q83IB9"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IB9"
FT                   /protein_id="CAD66801.1"
FT                   /translation="MTRKLEIPESRDLPDWSHIGGGKVRELYVHRQYKNILLMFASNRV
FT                   SAFDFVLEPEIPEKGRMLTQMSNWWFRKLPAENHLLENYDQELYRDLASHIPSHILERS
FT                   TICRKMDIIPFEFVIRGYLTGSAWADYLENNTVYGIKLKGKFRQGDRLPGPIFTPTTKS
FT                   RTKDTPVRYEDLVNAIGLSHAQQLREMCTDYYTTAEQIARNKGLIIADAKFEFGIAEGK
FT                   AYLADELLTADSARYWDINSWGQFDLPIERRLDSFDKQAVRDWVKCNSGKNITPQNITP
FT                   LRLPQELIQTVYKKYKTLLAKLTG"
     MTRKLEIPES RDLPDWSHIG GGKVRELYVH RQYKNILLMF ASNRVSAFDF VLEPEIPEKG        60
     RMLTQMSNWW FRKLPAENHL LENYDQELYR DLASHIPSHI LERSTICRKM DIIPFEFVIR       120
     GYLTGSAWAD YLENNTVYGI KLKGKFRQGD RLPGPIFTPT TKSRTKDTPV RYEDLVNAIG       180
     LSHAQQLREM CTDYYTTAEQ IARNKGLIIA DAKFEFGIAE GKAYLADELL TADSARYWDI       240
     NSWGQFDLPI ERRLDSFDKQ AVRDWVKCNS GKNITPQNIT PLRLPQELIQ TVYKKYKTLL       300
     AKLTG                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page