(data stored in ACNUC30630 zone)

EMBL: BX251410.PURE

BX251410.PURE        Location/Qualifiers
FT   CDS             28311..28853
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="TW029"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit PurE"
FT                   /EC_number="4.1.1.21"
FT                   /note="Similar to Corynebacterium ammoniagenes
FT                   phosphoribosylaminoimidazole carboxylase catalytic subunit
FT                   PurE SWALL:PUR6_CORAM (SWALL:Q44679) (177 aa) fasta scores:
FT                   E(): 7.7e-28, 55.09% id in 167 aa, and to Streptomyces
FT                   coelicolor phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit PurE or SCO3059 or SCBAC19G2.14c
FT                   SWALL:Q93J44 (EMBL:AL596138) (180 aa) fasta scores: E():
FT                   3.7e-27, 54.21% id in 166 aa"
FT                   /protein_id="CAD66721.1"
FT                   /translation="MTGKNINDEGSKCPALVWLLMGSDSDWPVMSGAADILQQMNISFR
FT                   VNVVSAHRQPEKMISCAKRARDMGFKVLIAAAGGAAHLPGMLASVTTLPVIGVPVGQKN
FT                   LSGLDSLLSIVQMPSGVPVACVGIDSAKNAALLAARILGVQSADIEASRIADSLSAYQQ
FT                   SLFDQSNEKDRMINEPK"
     MTGKNINDEG SKCPALVWLL MGSDSDWPVM SGAADILQQM NISFRVNVVS AHRQPEKMIS        60
     CAKRARDMGF KVLIAAAGGA AHLPGMLASV TTLPVIGVPV GQKNLSGLDS LLSIVQMPSG       120
     VPVACVGIDS AKNAALLAAR ILGVQSADIE ASRIADSLSA YQQSLFDQSN EKDRMINEPK       180
//

If you have problems or comments...

PBIL Back to PBIL home page