(data stored in ACNUC30630 zone)

EMBL: BX251410.PURH

BX251410.PURH        Location/Qualifiers
FT   CDS             93477..95105
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="TW094"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /note="Similar to Mycobacterium paratuberculosis PurH
FT                   SWALL:Q9RAJ5 (EMBL:AF191543) (527 aa) fasta scores: E():
FT                   8.2e-59, 50.46% id in 543 aa, and to Escherichia coli
FT                   bifunctional purine biosynthesis protein PurH [includes:
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase
FT                   purh or b4006 SWALL:PUR9_ECOLI (SWALL:P15639) (529 aa)
FT                   fasta scores: E(): 2.6e-27, 39.48% id in 547 aa"
FT                   /protein_id="CAD66778.1"
FT                   /translation="MTTNIRIKRALISVSDKSGLADLAEALAAHSVKIVSTGSTAEFIR
FT                   GVSIPVRDVSEVTGVGELLDGRVKTLHPKIHAPILADTTSQMHRAQLQQLGVDAFDLVV
FT                   VNLYPFFEISKNSEAEFSDVIEQIDIGGSALIRAAAKNHTRVVVIVDPSDYIHVINSLE
FT                   RGAPSRLRHQLAIKAYSHTSEYDLHISRWLSERFYKHTLYSSSDSVGDVCDNNLDSNDH
FT                   FVELRGKKLGDLRYGENSHQKASLYLSCKESVPQLGLASAALLGGKQMSYNNYLDADVA
FT                   SRIVNSFDLPTVSFVKHGNPCGIASNIEVAIACRNAHECDPTSAFGGVVAVNREVTLDV
FT                   ATHLLPIFIEVVVAPGYDPQALQLLLKKKNLRVVELPECASYPQDQLRQISGGFLVQDA
FT                   DKFDHHDTFSSWTQVSGPRIFMDAGADNETLMDLEFAWKSCAFVKSNAILLAKNMASVG
FT                   IGMGQVNRLDACYLAVNRAGSRSLGAVAASDAFFPFSDGLDVLINSGVKAIVQPGGSVR
FT                   DNAVIAAAQQAGVTMFFTGKRHFAH"
     MTTNIRIKRA LISVSDKSGL ADLAEALAAH SVKIVSTGST AEFIRGVSIP VRDVSEVTGV        60
     GELLDGRVKT LHPKIHAPIL ADTTSQMHRA QLQQLGVDAF DLVVVNLYPF FEISKNSEAE       120
     FSDVIEQIDI GGSALIRAAA KNHTRVVVIV DPSDYIHVIN SLERGAPSRL RHQLAIKAYS       180
     HTSEYDLHIS RWLSERFYKH TLYSSSDSVG DVCDNNLDSN DHFVELRGKK LGDLRYGENS       240
     HQKASLYLSC KESVPQLGLA SAALLGGKQM SYNNYLDADV ASRIVNSFDL PTVSFVKHGN       300
     PCGIASNIEV AIACRNAHEC DPTSAFGGVV AVNREVTLDV ATHLLPIFIE VVVAPGYDPQ       360
     ALQLLLKKKN LRVVELPECA SYPQDQLRQI SGGFLVQDAD KFDHHDTFSS WTQVSGPRIF       420
     MDAGADNETL MDLEFAWKSC AFVKSNAILL AKNMASVGIG MGQVNRLDAC YLAVNRAGSR       480
     SLGAVAASDA FFPFSDGLDV LINSGVKAIV QPGGSVRDNA VIAAAQQAGV TMFFTGKRHF       540
     AH                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page