(data stored in ACNUC30630 zone)

EMBL: BX251410.PURK

BX251410.PURK        Location/Qualifiers
FT   CDS             26979..28232
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="TW028"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit PurK"
FT                   /EC_number="4.1.1.21"
FT                   /note="Similar to Mycobacterium tuberculosis
FT                   phosphoribosylaminoimidazole carboxylase ATPase subunit
FT                   PurK or Rv3276c or mt3376 or mtcy71.16C SWALL:PURK_MYCTU
FT                   (SWALL:P96881) (429 aa) fasta scores: E(): 1.3e-21, 39.43%
FT                   id in 421 aa, and to Schizosaccharomyces pombe
FT                   phosphoribosylaminoimidazole carboxylase Ade6 or Min1 or
FT                   Spcc1322.13 SWALL:PUR6_SCHPO (SWALL:P15567) (552 aa) fasta
FT                   scores: E(): 1.5e-14, 32.15% id in 395 aa"
FT                   /protein_id="CAD66720.1"
FT                   /translation="MLSIARIASPAQYNLRLMFERLSCSVGVIGGGQLARMMIAPAQAL
FT                   GVDLKVFADTPDSSAALAATAFGSPENGAAVLEFAQTVDIVTFEHELVPADVLQLLDER
FT                   GIEMLPCPRALRYAQDKLALRRYLDEISVNQPAWAEVRSEGDLERFISEHGGCAVVKTG
FT                   GYDGRGVQVVTLSSEIDTCRNGGFLAEERIDFVCEVSQLVARSSIGEICVWPLTQTIQE
FT                   NGICVQTITPALGLSGGNALNQLTTFHDGRTRTPHAPLHSELITKLQDSAKTIALDIAR
FT                   GLNVVGVMAVEMFITQDGKLLVNELAMRPHNSGHWSMAASITDQFEQHLRAVLGLPLGA
FT                   TDMSHNCAIMVNIFNSISPAQYREVMTHWPDAKLHIYKKQPRPGRKIGHVVFAGEDLQQ
FT                   LAIAAEECRQLLRESHAV"
     MLSIARIASP AQYNLRLMFE RLSCSVGVIG GGQLARMMIA PAQALGVDLK VFADTPDSSA        60
     ALAATAFGSP ENGAAVLEFA QTVDIVTFEH ELVPADVLQL LDERGIEMLP CPRALRYAQD       120
     KLALRRYLDE ISVNQPAWAE VRSEGDLERF ISEHGGCAVV KTGGYDGRGV QVVTLSSEID       180
     TCRNGGFLAE ERIDFVCEVS QLVARSSIGE ICVWPLTQTI QENGICVQTI TPALGLSGGN       240
     ALNQLTTFHD GRTRTPHAPL HSELITKLQD SAKTIALDIA RGLNVVGVMA VEMFITQDGK       300
     LLVNELAMRP HNSGHWSMAA SITDQFEQHL RAVLGLPLGA TDMSHNCAIM VNIFNSISPA       360
     QYREVMTHWP DAKLHIYKKQ PRPGRKIGHV VFAGEDLQQL AIAAEECRQL LRESHAV          417
//

If you have problems or comments...

PBIL Back to PBIL home page