(data stored in ACNUC30630 zone)

EMBL: BX251410.PURN

BX251410.PURN        Location/Qualifiers
FT   CDS             92799..93437
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="TW093"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="Similar to Mycobacterium paratuberculosis PurN
FT                   SWALL:Q9RAJ6 (EMBL:AF191543) (209 aa) fasta scores: E():
FT                   1.5e-21, 42.39% id in 184 aa and to Escherichia coli
FT                   phosphoribosylglycinamide formyltransferase PurN or b2500
FT                   SWALL:PUR3_ECOLI (SWALL:P08179) (212 aa) fasta scores: E():
FT                   2.1e-17, 36.2% id in 174 aa"
FT                   /protein_id="CAD66777.1"
FT                   /translation="MKTAMRLIVMVSGIGSGLLRLIRACEQKELKAEIVAVGSDRHAPA
FT                   LSHASDYGIPFFVSPFKEYSNRDAWGANLLNTVLAYKPDLVVLSGFMRILPSCVVDALS
FT                   PNLINTHPSYLPEFPGMNAVEDALRAGVKTTGASVIRVDNGIDTGPVISQMRVKVYSSD
FT                   TCQTLHSRIKKVEHLLLCRAIKNIYTEQFILKNLLHNSVRRPSGKTGDR"
     MKTAMRLIVM VSGIGSGLLR LIRACEQKEL KAEIVAVGSD RHAPALSHAS DYGIPFFVSP        60
     FKEYSNRDAW GANLLNTVLA YKPDLVVLSG FMRILPSCVV DALSPNLINT HPSYLPEFPG       120
     MNAVEDALRA GVKTTGASVI RVDNGIDTGP VISQMRVKVY SSDTCQTLHS RIKKVEHLLL       180
     CRAIKNIYTE QFILKNLLHN SVRRPSGKTG DR                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page