(data stored in ACNUC30630 zone)

EMBL: BX251410.PYRG

BX251410.PYRG        Location/Qualifiers
FT   CDS             complement(111707..113344)
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="TW110"
FT                   /product="CTP synthetase"
FT                   /EC_number="6.3.4.2"
FT                   /note="Similar to Chlamydia trachomatis CTP synthetase PyrG
FT                   or Ct183 SWALL:PYRG_CHLTR (SWALL:Q59321) (539 aa) fasta
FT                   scores: E(): 4.8e-90, 48.3% id in 532 aa, and to
FT                   Streptomyces coelicolor putative CTP synthetase PyrG or
FT                   SCO1776 or SCI51.16c SWALL:Q9S224 (EMBL:AL109848) (549 aa)
FT                   fasta scores: E(): 1.2e-104, 58.92% id in 538 aa"
FT                   /db_xref="GOA:Q83IC4"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83IC4"
FT                   /protein_id="CAD66793.1"
FT                   /translation="MNGIKHIFITGGVVSSIGKGLTAASLGSLLTMRGLKVFIKKLDPY
FT                   LNVDPGTMNPLQHGEVFITEDGAETDLDVGHYERFLDVDLDRTANVTTGQVYSKVITLE
FT                   RTGRYLGETVQVIPHITDEIKRRIRLAPDDIDVIITEIGGTVGDIESQPFIEAARQIRR
FT                   EVGRENCCFIHVSLVPFLESAGEQKTKPTQHSVAILRAAGIQPDALVLRSDKPISSANQ
FT                   KKIALMCDVSAVVNAVTVPNIYEIPCVLNQHGLDKFVIKHLDLEAGEIDWSYWDDVLDA
FT                   IENNRSEIEIAIIGKYTGLPDAYISVIEALRAGGFESKTKVNIKWVDSDDENLEDQLEN
FT                   INGACIPGGFGIRGIEGLIKAIRICREREIPTLGICLGMQCMVIEYARHVVGMHGASST
FT                   EFTDDTQWPVVTTMLEQRDILIDDQFGGTMRLGSYRAVLSVGSLAASLYGTTDIHERHR
FT                   HRYEVNNGYAQRLVERGLIVSGRNTEQDLIEFIELDRKDHPFYIGTQAHPECKSRPKRP
FT                   HPLFKGLVAAALARKEIAEFNSGKTVLQ"
     MNGIKHIFIT GGVVSSIGKG LTAASLGSLL TMRGLKVFIK KLDPYLNVDP GTMNPLQHGE        60
     VFITEDGAET DLDVGHYERF LDVDLDRTAN VTTGQVYSKV ITLERTGRYL GETVQVIPHI       120
     TDEIKRRIRL APDDIDVIIT EIGGTVGDIE SQPFIEAARQ IRREVGRENC CFIHVSLVPF       180
     LESAGEQKTK PTQHSVAILR AAGIQPDALV LRSDKPISSA NQKKIALMCD VSAVVNAVTV       240
     PNIYEIPCVL NQHGLDKFVI KHLDLEAGEI DWSYWDDVLD AIENNRSEIE IAIIGKYTGL       300
     PDAYISVIEA LRAGGFESKT KVNIKWVDSD DENLEDQLEN INGACIPGGF GIRGIEGLIK       360
     AIRICREREI PTLGICLGMQ CMVIEYARHV VGMHGASSTE FTDDTQWPVV TTMLEQRDIL       420
     IDDQFGGTMR LGSYRAVLSV GSLAASLYGT TDIHERHRHR YEVNNGYAQR LVERGLIVSG       480
     RNTEQDLIEF IELDRKDHPF YIGTQAHPEC KSRPKRPHPL FKGLVAAALA RKEIAEFNSG       540
     KTVLQ                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page