(data stored in ACNUC30630 zone)

EMBL: BX251410.RECF

BX251410.RECF        Location/Qualifiers
FT   CDS             2890..3981
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="TW003"
FT                   /product="DNA replication and repair protein recF"
FT                   /note="Similar to Streptomyces coelicolor DNA replication
FT                   and repair protein RecF or SCO3876 or SCH18.13c
FT                   SWALL:RECF_STRCO (SWALL:P36176) (373 aa) fasta scores: E():
FT                   3.9e-24, 37.16% id in 374 aa"
FT                   /db_xref="GOA:Q83NZ4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83NZ4"
FT                   /protein_id="CAD66695.1"
FT                   /translation="MQNNLISHINLRNFRNYEYQSISFTDGLNLIRGDNGQGKTNLAEA
FT                   IYFLSGFGSHRTYKNQPLIKSGEQKAEISAKIQSKYGTRNVYIGISCNSNNILKVDGKP
FT                   SKLRDLVSVFSCVIFSPEDIDLVKGDPGHRRKYLDDIICRARPMMLDIYSAYDRTLKQR
FT                   NSLLKSFRKSSCKSDLLDIWTQKLVELGLEIVNARKRLLKILNPKISEFYSKLAGVSST
FT                   AELFCQSSDCLIDTFDLLRDREIEEGVTLAGPHRDNVDILLNSCPARSQSSQGESWTLA
FT                   LSMKLSLIELMRETKRLYDPDPVVILDDVFAHLDSYRKQKLAQEVFSYEQTIVTTTDNS
FT                   DNYRTSQTLVVEEGKVFSENKKG"
     MQNNLISHIN LRNFRNYEYQ SISFTDGLNL IRGDNGQGKT NLAEAIYFLS GFGSHRTYKN        60
     QPLIKSGEQK AEISAKIQSK YGTRNVYIGI SCNSNNILKV DGKPSKLRDL VSVFSCVIFS       120
     PEDIDLVKGD PGHRRKYLDD IICRARPMML DIYSAYDRTL KQRNSLLKSF RKSSCKSDLL       180
     DIWTQKLVEL GLEIVNARKR LLKILNPKIS EFYSKLAGVS STAELFCQSS DCLIDTFDLL       240
     RDREIEEGVT LAGPHRDNVD ILLNSCPARS QSSQGESWTL ALSMKLSLIE LMRETKRLYD       300
     PDPVVILDDV FAHLDSYRKQ KLAQEVFSYE QTIVTTTDNS DNYRTSQTLV VEEGKVFSEN       360
     KKG                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page