(data stored in ACNUC30630 zone)

EMBL: BX251410.RECG

BX251410.RECG        Location/Qualifiers
FT   CDS             232840..234861
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="TW195"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="Similar to Staphylococcus aureus ATP-dependent DNA
FT                   helicase RecG SWALL:RECG_STAAU (SWALL:O50581) (686 aa)
FT                   fasta scores: E(): 3.9e-62, 32.43% id in 666 aa"
FT                   /protein_id="CAD66872.1"
FT                   /translation="MASLLAKEFGISRVIDLLTYYPRRYICRGKLTKLSELIPGDEVTI
FT                   VGRVLSTEQRKTFSGANFLSVTLSDGENIIQLVFFHQPWRAENLKPGACGLFSGKVTEF
FT                   NNKKQLSHPEYELFSSEPTREQIQKWNEQIIPIYRACIACPSWKIARAVDLALEAVKGQ
FT                   TVDFMSGNYGYMSVEKAFYVIHHPTDNEELEAAKESLRFFEAFLLQSALLHRKRFRNRA
FT                   SATPFIRKNGGFLERFDARLEFSQTNDQLRAADEIFEDLSLSEPMTRLLHGEVGSGKTL
FT                   VAIRAMLLAADNDMQAVLVAPTEVLAKQHHRNLTRMLGHELCAEIQPSLLLGREKHTLR
FT                   IASGRSKIIIGTHSVFSKKTVFHNLALVVIDEQHRFGVGQRDELLLKGDSPHLLMLSAT
FT                   PIPRTVALSLLNFIAISEIKTPPSGKAEISTHVVPLAEKPQWGREVIRRISEEIQKGHQ
FT                   VFVVAPVIEQSRTGAASISALLRELEETPLLQGAKISRLHGKLTAAECEKSMEEFSCGA
FT                   SDILLSTTMIEVGIDVPNATAMVIVSADRFGIAQLHQLRGRIGRGNLPGVCLLVTNAPE
FT                   GSAARSRLDLVARTHDGFSLAEIDMKMRREGDLLGLGQSGQGNYRLLRLDEDLQVLSDA
FT                   RLHAEGIMENDIKLEKNKLLRLFLSQYLSGTNLSRLLS"
     MASLLAKEFG ISRVIDLLTY YPRRYICRGK LTKLSELIPG DEVTIVGRVL STEQRKTFSG        60
     ANFLSVTLSD GENIIQLVFF HQPWRAENLK PGACGLFSGK VTEFNNKKQL SHPEYELFSS       120
     EPTREQIQKW NEQIIPIYRA CIACPSWKIA RAVDLALEAV KGQTVDFMSG NYGYMSVEKA       180
     FYVIHHPTDN EELEAAKESL RFFEAFLLQS ALLHRKRFRN RASATPFIRK NGGFLERFDA       240
     RLEFSQTNDQ LRAADEIFED LSLSEPMTRL LHGEVGSGKT LVAIRAMLLA ADNDMQAVLV       300
     APTEVLAKQH HRNLTRMLGH ELCAEIQPSL LLGREKHTLR IASGRSKIII GTHSVFSKKT       360
     VFHNLALVVI DEQHRFGVGQ RDELLLKGDS PHLLMLSATP IPRTVALSLL NFIAISEIKT       420
     PPSGKAEIST HVVPLAEKPQ WGREVIRRIS EEIQKGHQVF VVAPVIEQSR TGAASISALL       480
     RELEETPLLQ GAKISRLHGK LTAAECEKSM EEFSCGASDI LLSTTMIEVG IDVPNATAMV       540
     IVSADRFGIA QLHQLRGRIG RGNLPGVCLL VTNAPEGSAA RSRLDLVART HDGFSLAEID       600
     MKMRREGDLL GLGQSGQGNY RLLRLDEDLQ VLSDARLHAE GIMENDIKLE KNKLLRLFLS       660
     QYLSGTNLSR LLS                                                          673
//

If you have problems or comments...

PBIL Back to PBIL home page