(data stored in ACNUC30630 zone)

EMBL: BX251410.RIBF

BX251410.RIBF        Location/Qualifiers
FT   CDS             221811..222749
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="TW180"
FT                   /product="riboflavin biosynthesis protein RibF [includes:
FT                   riboflavin kinase]"
FT                   /EC_number="2.7.1.26"
FT                   /note="Similar to Escherichia coli riboflavin biosynthesis
FT                   protein RibF [includes: riboflavin kinase] or b0025 or
FT                   z0029 or ecs0028 SWALL:RIBF_ECOLI (SWALL:P08391) (313 aa)
FT                   fasta scores: E(): 8.3e-30, 35.33% id in 317 aa"
FT                   /protein_id="CAD66859.1"
FT                   /translation="MRVFRSFDCLGRDKRTALTIGKFDGVHLGHRRLLERIVALQNQDT
FT                   SALVVTFDRDPKTFFKKDMSFVPLCSLEQKLSLLENCNIPNCLILRFDDEFASMSAEDF
FT                   VHKVLLEKLNMSSIVIGDGFRFGARGLGDAMLLEKLARELGFYLEVIPKIQFGKTNISS
FT                   TLIRKFLSLGQAGNASSCLGRNHVCTGTVVHGKKRGRELGFPTANLGKDVSGFIPADGV
FT                   YIGRIISDRSYPAAVSIGRNPTFGDLEFSQIEAHALYEDISSLDLYGRRIDVEFIAHLR
FT                   DTMLYKSIDSLKAAIRSDVERCKEYFSTTVG"
     MRVFRSFDCL GRDKRTALTI GKFDGVHLGH RRLLERIVAL QNQDTSALVV TFDRDPKTFF        60
     KKDMSFVPLC SLEQKLSLLE NCNIPNCLIL RFDDEFASMS AEDFVHKVLL EKLNMSSIVI       120
     GDGFRFGARG LGDAMLLEKL ARELGFYLEV IPKIQFGKTN ISSTLIRKFL SLGQAGNASS       180
     CLGRNHVCTG TVVHGKKRGR ELGFPTANLG KDVSGFIPAD GVYIGRIISD RSYPAAVSIG       240
     RNPTFGDLEF SQIEAHALYE DISSLDLYGR RIDVEFIAHL RDTMLYKSID SLKAAIRSDV       300
     ERCKEYFSTT VG                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page