(data stored in ACNUC30630 zone)

EMBL: BX251410.RNC

BX251410.RNC         Location/Qualifiers
FT   CDS             237204..237851
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="TW199"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="Similar to Escherichia coli ribonuclease III Rnc or
FT                   b2567 or z3848 or ecs3433 SWALL:RNC_ECOLI (SWALL:P05797)
FT                   (226 aa) fasta scores: E(): 3e-18, 35% id in 220 aa, and to
FT                   Streptomyces coelicolor ribonuclease III Rnc or SCO5572 or
FT                   SC7A1.16 SWALL:RNC_STRCO (SWALL:Q9ZBQ7) (272 aa) fasta
FT                   scores: E(): 3.9e-26, 42.05% id in 214 aa"
FT                   /db_xref="GOA:Q83I82"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I82"
FT                   /protein_id="CAD66876.1"
FT                   /translation="MRKFNLTLPPGLLRTAFVHKSFSFENGACQNNERLEFLGDAVLGL
FT                   VVSHYLFETCPEYTEGQLSAARSYIVSGTSIAQIAKELNLGQFMLLGKGEKLAGGMDKT
FT                   SLLADLLESLIGAVMVDQGFESARDFVLALVGEKLRQVGEFSVDDPKTKLQKLTRTQLV
FT                   YEVVTEGPPHSRTFKASVIVNEKRFFGQGSSKKQAQVAAAMSALASLENKSS"
     MRKFNLTLPP GLLRTAFVHK SFSFENGACQ NNERLEFLGD AVLGLVVSHY LFETCPEYTE        60
     GQLSAARSYI VSGTSIAQIA KELNLGQFML LGKGEKLAGG MDKTSLLADL LESLIGAVMV       120
     DQGFESARDF VLALVGEKLR QVGEFSVDDP KTKLQKLTRT QLVYEVVTEG PPHSRTFKAS       180
     VIVNEKRFFG QGSSKKQAQV AAAMSALASL ENKSS                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page