(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLB

BX251410.RPLB        Location/Qualifiers
FT   CDS             245758..246591
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="TW210"
FT                   /product="50s ribosomal protein l2"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein l2
FT                   RplB or b3317 or z4688 or ecs4182 SWALL:RL2_ECOLI
FT                   (SWALL:P02387) (272 aa) fasta scores: E(): 6e-60, 56.93% id
FT                   in 274 aa"
FT                   /db_xref="GOA:Q83I75"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I75"
FT                   /protein_id="CAD66887.1"
FT                   /translation="MAVRKSNPLTPARRGMSFSDFAEITRATPHKSLLSKLSKTGGRNN
FT                   HGRITARHIGGGHKRRYRLVDFRRSDKDGVKAKVAHIEYDPNRTARIALLHFLDGAKRY
FT                   ILAPSGLKQGDVVESGSSADIRPGNSLCIRDIPVGTILHAVELRPGQGAKLARSAGSSV
FT                   RLSAKDGDFAILKLPSGEIRMVSLSCRATIGEVGNGQRLNVSLGKAGRSRWCGVRPSVR
FT                   GVAMNPVDHPHGGGEGKTSGGRHPVSPWGRPEGKTRRANKPSDRFIIRRKSRKRR"
     MAVRKSNPLT PARRGMSFSD FAEITRATPH KSLLSKLSKT GGRNNHGRIT ARHIGGGHKR        60
     RYRLVDFRRS DKDGVKAKVA HIEYDPNRTA RIALLHFLDG AKRYILAPSG LKQGDVVESG       120
     SSADIRPGNS LCIRDIPVGT ILHAVELRPG QGAKLARSAG SSVRLSAKDG DFAILKLPSG       180
     EIRMVSLSCR ATIGEVGNGQ RLNVSLGKAG RSRWCGVRPS VRGVAMNPVD HPHGGGEGKT       240
     SGGRHPVSPW GRPEGKTRRA NKPSDRFIIR RKSRKRR                                277
//

If you have problems or comments...

PBIL Back to PBIL home page