(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLC

BX251410.RPLC        Location/Qualifiers
FT   CDS             244074..244706
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="TW207"
FT                   /product="50S ribosomal protein L3"
FT                   /note="Similar to Escherichia coli 50s ribosomal protein L3
FT                   RplC or b3320 or z4691 or ecs4185 SWALL:RL3_ECOLI
FT                   (SWALL:P02386) (209 aa) fasta scores: E(): 2.1e-32, 49.26%
FT                   id in 205 aa"
FT                   /db_xref="GOA:Q83I78"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I78"
FT                   /protein_id="CAD66884.1"
FT                   /translation="MARALLGTKVGMTQIWSGRRVVPVTAVAVTTNVVSQVKAPEKDGY
FT                   SRLQIATGAIDPRRVNRPRKGHFAKAGLTPRRFIREVDSEGSLGDEFGPEIFQEGQLVD
FT                   VVGKSKGKGFSGTMKRHNFQGVSATHGSHRNHRKPGSVGASSTPSRVFKGTRMAGRLGS
FT                   SRVTVHNLRLVKIDSENGLLLVEGAVPGSSGSPVIIRDAVKGVPIVS"
     MARALLGTKV GMTQIWSGRR VVPVTAVAVT TNVVSQVKAP EKDGYSRLQI ATGAIDPRRV        60
     NRPRKGHFAK AGLTPRRFIR EVDSEGSLGD EFGPEIFQEG QLVDVVGKSK GKGFSGTMKR       120
     HNFQGVSATH GSHRNHRKPG SVGASSTPSR VFKGTRMAGR LGSSRVTVHN LRLVKIDSEN       180
     GLLLVEGAVP GSSGSPVIIR DAVKGVPIVS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page