(data stored in ACNUC30630 zone)

EMBL: BX251410.RPLD

BX251410.RPLD        Location/Qualifiers
FT   CDS             244696..245442
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="TW208"
FT                   /product="50s ribosomal protein L4"
FT                   /note="Similar to Bacillus stearothermophilus 50s ribosomal
FT                   protein L4 RplD SWALL:RL4_BACST (SWALL:P28601) (207 aa)
FT                   fasta scores: E(): 6.1e-28, 41.62% id in 197 aa"
FT                   /db_xref="GOA:Q83I77"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q83I77"
FT                   /protein_id="CAD66885.1"
FT                   /translation="MSPSATVFDIGGNAVGTLQLVGHLFDSDPNLHLIHQVVVAQQAAF
FT                   RQGTHKTKSRAEVSGSGRKPFRQKGTGNARCGSTRAPQMRGGGVVHGPVPRSYVHRTPK
FT                   KMIKAALAGCLTNRARAGRVHIVDSFGDTPSVADALTLFQITGLSSKLLVVAQASDSVA
FT                   YRSVRNIPGVRLVHVGQLNSYDVLRSDDVLFTRGAYNVFVGPSGDLAFSEDRDNPGTSL
FT                   PKSPTPEDSSDATKARSSRHDDRTGA"
     MSPSATVFDI GGNAVGTLQL VGHLFDSDPN LHLIHQVVVA QQAAFRQGTH KTKSRAEVSG        60
     SGRKPFRQKG TGNARCGSTR APQMRGGGVV HGPVPRSYVH RTPKKMIKAA LAGCLTNRAR       120
     AGRVHIVDSF GDTPSVADAL TLFQITGLSS KLLVVAQASD SVAYRSVRNI PGVRLVHVGQ       180
     LNSYDVLRSD DVLFTRGAYN VFVGPSGDLA FSEDRDNPGT SLPKSPTPED SSDATKARSS       240
     RHDDRTGA                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page